BLASTX nr result
ID: Scutellaria23_contig00013955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013955 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277185.1| PREDICTED: ribosome biogenesis GTPase A [Vit... 57 2e-06 ref|XP_004143028.1| PREDICTED: ribosome biogenesis GTPase A-like... 55 8e-06 >ref|XP_002277185.1| PREDICTED: ribosome biogenesis GTPase A [Vitis vinifera] gi|297744953|emb|CBI38545.3| unnamed protein product [Vitis vinifera] Length = 369 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 140 IQNIGKAVKAVVKGRSSEWWYTPHMAAASRAIADRIPLVDLVLEVR 3 I N+ K + + VK R+++ W++PHMAAASRA+++RIPLVDLVLEVR Sbjct: 3 IANLEKRLGSGVK-RAAKTWFSPHMAAASRAVSERIPLVDLVLEVR 47 >ref|XP_004143028.1| PREDICTED: ribosome biogenesis GTPase A-like [Cucumis sativus] gi|449482814|ref|XP_004156412.1| PREDICTED: ribosome biogenesis GTPase A-like [Cucumis sativus] Length = 366 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -3 Query: 143 LIQNIGKAVKAVVKG-RSSEWWYTPHMAAASRAIADRIPLVDLVLEVR 3 L++ IG A+ + G R S WY HM AASRA+A+RIPLVD VLEVR Sbjct: 6 LMRKIGTAINQLAAGNRISSGWYDAHMEAASRAVAERIPLVDFVLEVR 53