BLASTX nr result
ID: Scutellaria23_contig00013740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013740 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271313.1| PREDICTED: pentatricopeptide repeat-containi... 52 4e-07 emb|CBI31981.3| unnamed protein product [Vitis vinifera] 52 4e-07 >ref|XP_002271313.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26900, mitochondrial-like [Vitis vinifera] Length = 597 Score = 51.6 bits (122), Expect(2) = 4e-07 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +2 Query: 239 GLFFMLQNTLLHFSFVCSRIQNAHQLFDEMGGREDLVSW 355 GLF ++N LLHF VC RI +AHQLFDE+ + DLVSW Sbjct: 159 GLFTNVKNALLHFYCVCGRIGDAHQLFDEIPPKIDLVSW 197 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 93 FKLHEGTNSQRNDLSLNQFVVISVQRSCSCLLEISTGIAIHAIVVK 230 F + +G +Q+ + L+QF I ++C+ L TG IH +VV+ Sbjct: 112 FVVFKGLRAQQ--MILDQFSFIPTLKACARELAYETGQGIHGVVVR 155 >emb|CBI31981.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 51.6 bits (122), Expect(2) = 4e-07 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +2 Query: 239 GLFFMLQNTLLHFSFVCSRIQNAHQLFDEMGGREDLVSW 355 GLF ++N LLHF VC RI +AHQLFDE+ + DLVSW Sbjct: 159 GLFTNVKNALLHFYCVCGRIGDAHQLFDEIPPKIDLVSW 197 Score = 27.7 bits (60), Expect(2) = 4e-07 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 93 FKLHEGTNSQRNDLSLNQFVVISVQRSCSCLLEISTGIAIHAIVVK 230 F + +G +Q+ + L+QF I ++C+ L TG IH +VV+ Sbjct: 112 FVVFKGLRAQQ--MILDQFSFIPTLKACARELAYETGQGIHGVVVR 155