BLASTX nr result
ID: Scutellaria23_contig00013692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013692 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH56966.1| AT4G36850 [Arabidopsis thaliana] 64 1e-08 gb|EEE54293.1| hypothetical protein OsJ_01221 [Oryza sativa Japo... 62 9e-08 gb|EEC70372.1| hypothetical protein OsI_01310 [Oryza sativa Indi... 62 9e-08 ref|XP_002984766.1| hypothetical protein SELMODRAFT_121256 [Sela... 59 4e-07 ref|XP_002985826.1| hypothetical protein SELMODRAFT_123042 [Sela... 59 4e-07 >dbj|BAH56966.1| AT4G36850 [Arabidopsis thaliana] Length = 376 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 568 SILVRTIDWDKIKPNMPWLLDAGVCVLLDIFVSFSH 461 SILVRT +WD IKPN+PWLLDA VCV+LD+FVSFS+ Sbjct: 326 SILVRTTEWDNIKPNLPWLLDAIVCVVLDLFVSFSN 361 >gb|EEE54293.1| hypothetical protein OsJ_01221 [Oryza sativa Japonica Group] Length = 427 Score = 61.6 bits (148), Expect = 9e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -2 Query: 568 SILVRTIDWDKIKPNMPWLLDAGVCVLLDIFVSFSHL 458 SILV+++DW K+KPN+PWL+DAG CVLLD FVSF L Sbjct: 358 SILVKSMDWSKLKPNLPWLVDAGGCVLLDTFVSFCKL 394 >gb|EEC70372.1| hypothetical protein OsI_01310 [Oryza sativa Indica Group] Length = 427 Score = 61.6 bits (148), Expect = 9e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -2 Query: 568 SILVRTIDWDKIKPNMPWLLDAGVCVLLDIFVSFSHL 458 SILV+++DW K+KPN+PWL+DAG CVLLD FVSF L Sbjct: 358 SILVKSMDWSKLKPNLPWLVDAGGCVLLDTFVSFCKL 394 >ref|XP_002984766.1| hypothetical protein SELMODRAFT_121256 [Selaginella moellendorffii] gi|300147352|gb|EFJ14016.1| hypothetical protein SELMODRAFT_121256 [Selaginella moellendorffii] Length = 391 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 568 SILVRTIDWDKIKPNMPWLLDAGVCVLLDIFVSF 467 SILVR+ DW K+KPNMPWL+DA VCV+LD FV F Sbjct: 312 SILVRSTDWTKLKPNMPWLVDAAVCVILDFFVWF 345 >ref|XP_002985826.1| hypothetical protein SELMODRAFT_123042 [Selaginella moellendorffii] gi|300146333|gb|EFJ13003.1| hypothetical protein SELMODRAFT_123042 [Selaginella moellendorffii] Length = 391 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 568 SILVRTIDWDKIKPNMPWLLDAGVCVLLDIFVSF 467 SILVR+ DW K+KPNMPWL+DA VCV+LD FV F Sbjct: 312 SILVRSTDWTKLKPNMPWLVDAAVCVILDFFVWF 345