BLASTX nr result
ID: Scutellaria23_contig00013650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013650 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532584.1| pentatricopeptide repeat-containing protein,... 70 2e-10 ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 5e-10 ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|AAG51690.1|AC016972_9 hypothetical protein; 66200-63606 [Arab... 63 3e-08 >ref|XP_002532584.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527693|gb|EEF29801.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 895 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = +1 Query: 382 HSDLVHYFRDWFLSRKDPLFERIFEILRTQNGPSIDSALSGFNLRLSESLVLDVLNY--E 555 + +V F++WF ++ + +R+FEIL Q+ + ALS LRL+ESLVLDVL+Y Sbjct: 72 YKHVVQSFKEWFKTQNNGFLDRVFEILSNQDEVD-ELALSQLGLRLTESLVLDVLHYGNS 130 Query: 556 KKDILPCLKFFDW 594 KKD+L CLKFFDW Sbjct: 131 KKDVLSCLKFFDW 143 >ref|XP_004172369.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71210-like, partial [Cucumis sativus] Length = 889 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 8/72 (11%) Frame = +1 Query: 403 FRDWFLSRKDPLFERIFEILR----TQNGP----SIDSALSGFNLRLSESLVLDVLNYEK 558 F++WF S +PL+ +IF+ILR Q P + D ALS LRL+ES VLDVL + Sbjct: 61 FKEWFKSGSNPLYGKIFQILRGARDDQEIPYRPSAADLALSRLGLRLNESFVLDVLRFGS 120 Query: 559 KDILPCLKFFDW 594 KD+L CLKFFDW Sbjct: 121 KDVLSCLKFFDW 132 >ref|XP_004144802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Cucumis sativus] Length = 913 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 8/72 (11%) Frame = +1 Query: 403 FRDWFLSRKDPLFERIFEILR----TQNGP----SIDSALSGFNLRLSESLVLDVLNYEK 558 F++WF S +PL+ +IF+ILR Q P + D ALS LRL+ES VLDVL + Sbjct: 85 FKEWFKSGSNPLYGKIFQILRGARDDQEIPYRPSAADLALSRLGLRLNESFVLDVLRFGS 144 Query: 559 KDILPCLKFFDW 594 KD+L CLKFFDW Sbjct: 145 KDVLSCLKFFDW 156 >ref|XP_003545174.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71210-like [Glycine max] Length = 868 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 8/81 (9%) Frame = +1 Query: 376 VHHSDLVHYFRDWFLSRK------DPLFERIFEILRTQNGPSIDSALSGFNLRLSESLVL 537 + +D+ F+ WF S + DPL RI +IL + + +ALS L LSE LVL Sbjct: 48 ISQNDVASSFKTWFASARQQQLPFDPLLNRIHQILSSPDDEDFSAALSALRLPLSERLVL 107 Query: 538 DVLNY--EKKDILPCLKFFDW 594 VL + ++DILPCLKFFDW Sbjct: 108 RVLCHGAARRDILPCLKFFDW 128 >gb|AAG51690.1|AC016972_9 hypothetical protein; 66200-63606 [Arabidopsis thaliana] Length = 864 Score = 63.2 bits (152), Expect = 3e-08 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 8/76 (10%) Frame = +1 Query: 391 LVHYFRDWFLSR----KDPLFERIFEILRTQNGPSIDSA----LSGFNLRLSESLVLDVL 546 LV ++DWF R L +RIF+ILR + D A LS LRL+E VLDVL Sbjct: 45 LVREWKDWFKHRDVKQSHQLIDRIFDILRAPSNDGDDRAFYLHLSNLRLRLTEKFVLDVL 104 Query: 547 NYEKKDILPCLKFFDW 594 ++ + DIL CLKFFDW Sbjct: 105 SHTRYDILCCLKFFDW 120