BLASTX nr result
ID: Scutellaria23_contig00013552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013552 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330586.1| amino acid permease [Populus trichocarpa] gi... 57 2e-06 ref|XP_002533727.1| amino acid transporter, putative [Ricinus co... 55 5e-06 >ref|XP_002330586.1| amino acid permease [Populus trichocarpa] gi|222872144|gb|EEF09275.1| amino acid permease [Populus trichocarpa] Length = 159 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 3 ISSNLLCDCYRYPHPEVGHIRNRSYAEAVSSYLGKSCEV 119 +S+ LLCDCYR+P PE G IRNRSY EAV YLG+ +V Sbjct: 76 VSTYLLCDCYRFPDPEHGPIRNRSYMEAVKFYLGEKSQV 114 >ref|XP_002533727.1| amino acid transporter, putative [Ricinus communis] gi|223526365|gb|EEF28658.1| amino acid transporter, putative [Ricinus communis] Length = 461 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +3 Query: 3 ISSNLLCDCYRYPHPEVGHIRNRSYAEAVSSYLGKSCE-VCELDWYIEPMIY 155 +S+ LLCDCYR+PHPE+G RNRSY +AV LGK +C + ++E +Y Sbjct: 72 LSTYLLCDCYRFPHPELGPSRNRSYLQAVDVSLGKKASWICGI--FVELSLY 121