BLASTX nr result
ID: Scutellaria23_contig00013487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013487 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding sub... 64 5e-10 gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptas... 68 9e-10 ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|... 66 3e-09 gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptas... 65 4e-09 ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [S... 64 1e-08 >ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355513943|gb|AES95566.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 1723 Score = 64.3 bits (155), Expect(2) = 5e-10 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = +3 Query: 39 GRYIQNL--MFMQSLSFPEALNDTNVVLMPKCENRATLEDLRPISLCYVLYKIISKVLAD 212 GRYI ++ + SFP LN TN+ L+PK + +++++D RPI+LC VLYKI++KVLA+ Sbjct: 902 GRYIFEAACFWLDNGSFPSCLNSTNITLIPKGDTQSSMKDWRPIALCNVLYKIVAKVLAN 961 Query: 213 RL 218 RL Sbjct: 962 RL 963 Score = 24.3 bits (51), Expect(2) = 5e-10 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 275 IQYILKTCDRFAWEYL 322 IQYI DR WEYL Sbjct: 998 IQYISTAYDRINWEYL 1013 >gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 653 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +3 Query: 78 SFPEALNDTNVVLMPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 230 + P AL DTN+VL+PKC++ T+ DLRPISLC V+YKI++K LA+RL ++L Sbjct: 71 NLPTALGDTNIVLIPKCDHPRTMRDLRPISLCNVVYKILAKTLANRLQRVL 121 >ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|355505315|gb|AES86457.1| CNGC5-like protein [Medicago truncatula] Length = 1023 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/46 (58%), Positives = 41/46 (89%) Frame = +3 Query: 81 FPEALNDTNVVLMPKCENRATLEDLRPISLCYVLYKIISKVLADRL 218 FP +LN+TN+ L+PKC++ +++D+RPISLC VLYK++SK+LA+RL Sbjct: 85 FPSSLNETNICLIPKCDSPKSMKDMRPISLCNVLYKMLSKLLANRL 130 >gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 573 Score = 65.5 bits (158), Expect = 4e-09 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = +3 Query: 63 FMQSLSFPEALNDTNVVLMPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 230 ++ S SFP LN T++VL PK +N ++DLRPISLC VLYKIISKVLA+RL L+ Sbjct: 34 WLTSGSFPPELNATHIVLAPKGDNPEYMKDLRPISLCNVLYKIISKVLANRLRPLI 89 >ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] gi|241926916|gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] Length = 631 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 84 PEALNDTNVVLMPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 230 PE NDT +VL+PK L+DLRPISLC VLYK+ISKVLA+RL K+L Sbjct: 62 PEGWNDTIIVLIPKTNTPQMLKDLRPISLCNVLYKLISKVLANRLKKIL 110