BLASTX nr result
ID: Scutellaria23_contig00013221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013221 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB38782.1| ferrochelatase isoform I [Nicotiana tabacum] 59 5e-07 >gb|AEB38782.1| ferrochelatase isoform I [Nicotiana tabacum] Length = 487 Score = 58.9 bits (141), Expect = 5e-07 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +1 Query: 364 PTFLNTTKSLMHSDKRMSTAKGLSISRPVEK-DIVGKTFCSAGVVTYPGNAIESHSQTAE 540 PT + L +K+ S G S+ RPV K D VGKTFCS G TYPG+ ES SQT E Sbjct: 50 PTEQELSLVLSSENKKSSVFGGSSLHRPVHKRDPVGKTFCSVGAYTYPGSIAESPSQTTE 109 Query: 541 EKI 549 EKI Sbjct: 110 EKI 112