BLASTX nr result
ID: Scutellaria23_contig00013200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00013200 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974273.1| charged multivesicular body protein 5 [Arabidop... 79 4e-13 ref|NP_187675.2| charged multivesicular body protein 5 [Arabidop... 79 4e-13 ref|NP_001190228.1| charged multivesicular body protein 5 [Arabi... 78 6e-13 gb|AAM66939.1| unknown [Arabidopsis thaliana] 78 6e-13 ref|NP_568143.1| charged multivesicular body protein 5 [Arabidop... 78 6e-13 >ref|NP_974273.1| charged multivesicular body protein 5 [Arabidopsis thaliana] gi|332641417|gb|AEE74938.1| charged multivesicular body protein 5 [Arabidopsis thaliana] Length = 170 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 457 YLQPDKETDLDADLNLPSAPSGHAPIPGGRVQAEDELGLPAVPRATLRG 311 YLQPD ETD D++LNLP+AP+GH P GR QAEDE GLPAVPRA+LRG Sbjct: 122 YLQPDTETDYDSELNLPAAPTGHNGAPHGRAQAEDEFGLPAVPRASLRG 170 >ref|NP_187675.2| charged multivesicular body protein 5 [Arabidopsis thaliana] gi|8567798|gb|AAF76370.1| unknown protein [Arabidopsis thaliana] gi|29028830|gb|AAO64794.1| At3g10640 [Arabidopsis thaliana] gi|110736412|dbj|BAF00173.1| hypothetical protein [Arabidopsis thaliana] gi|332641416|gb|AEE74937.1| charged multivesicular body protein 5 [Arabidopsis thaliana] Length = 235 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 457 YLQPDKETDLDADLNLPSAPSGHAPIPGGRVQAEDELGLPAVPRATLRG 311 YLQPD ETD D++LNLP+AP+GH P GR QAEDE GLPAVPRA+LRG Sbjct: 187 YLQPDTETDYDSELNLPAAPTGHNGAPHGRAQAEDEFGLPAVPRASLRG 235 >ref|NP_001190228.1| charged multivesicular body protein 5 [Arabidopsis thaliana] gi|332003412|gb|AED90795.1| charged multivesicular body protein 5 [Arabidopsis thaliana] Length = 272 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -3 Query: 457 YLQPDKETDLDADLNLPSAPSGHAPIPGGRVQAEDELGLPAVPRATLRG 311 YLQPDKE DL+ +LNLPSAP GH P GR QAEDE GLPAVPRA+LRG Sbjct: 224 YLQPDKEPDLNDELNLPSAPMGHTGAPPGRAQAEDEWGLPAVPRASLRG 272 >gb|AAM66939.1| unknown [Arabidopsis thaliana] Length = 235 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -3 Query: 457 YLQPDKETDLDADLNLPSAPSGHAPIPGGRVQAEDELGLPAVPRATLRG 311 YLQPDKE DL+ +LNLPSAP GH P GR QAEDE GLPAVPRA+LRG Sbjct: 187 YLQPDKEPDLNDELNLPSAPMGHTGAPPGRAQAEDEWGLPAVPRASLRG 235 >ref|NP_568143.1| charged multivesicular body protein 5 [Arabidopsis thaliana] gi|13877957|gb|AAK44056.1|AF370241_1 unknown protein [Arabidopsis thaliana] gi|9758460|dbj|BAB08989.1| unnamed protein product [Arabidopsis thaliana] gi|23296841|gb|AAN13183.1| unknown protein [Arabidopsis thaliana] gi|332003411|gb|AED90794.1| charged multivesicular body protein 5 [Arabidopsis thaliana] Length = 235 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -3 Query: 457 YLQPDKETDLDADLNLPSAPSGHAPIPGGRVQAEDELGLPAVPRATLRG 311 YLQPDKE DL+ +LNLPSAP GH P GR QAEDE GLPAVPRA+LRG Sbjct: 187 YLQPDKEPDLNDELNLPSAPMGHTGAPPGRAQAEDEWGLPAVPRASLRG 235