BLASTX nr result
ID: Scutellaria23_contig00012195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00012195 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW89467.1| low molecular weight heat shock protein [Gossypiu... 68 7e-10 gb|AAQ19680.1| chloroplast small heat shock protein class I [Cap... 68 9e-10 gb|AFV46377.1| ACD-ScHsp26-like protein [Tamarix hispida] 67 1e-09 gb|AAA61632.1| low molecular weight heat-shock protein [Papaver ... 66 3e-09 gb|ADM47405.1| small molecular heat shock protein [Nicotiana tab... 66 3e-09 >gb|ABW89467.1| low molecular weight heat shock protein [Gossypium hirsutum] Length = 158 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 129 MSLIPSFFGNRRSNVFDPLSLDIWDPFQGFPLSSPS 236 MSLIPSFFGNRRS+ FDP SLD+WDPF+ FP SSPS Sbjct: 1 MSLIPSFFGNRRSSAFDPFSLDVWDPFKDFPFSSPS 36 >gb|AAQ19680.1| chloroplast small heat shock protein class I [Capsicum frutescens] Length = 159 Score = 67.8 bits (164), Expect = 9e-10 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 129 MSLIPSFFGNRRSNVFDPLSLDIWDPFQGFPLSS 230 MS+IPSFFG RRSN+FDP+SLD+WDPF+GFP+SS Sbjct: 1 MSMIPSFFGGRRSNIFDPVSLDLWDPFEGFPISS 34 >gb|AFV46377.1| ACD-ScHsp26-like protein [Tamarix hispida] Length = 163 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 129 MSLIPSFFGNRRSNVFDPLSLDIWDPFQGFPLSSPS 236 MSLIPSFFG RRSNVFDP SLD+WDPFQGFP S PS Sbjct: 1 MSLIPSFFGGRRSNVFDPFSLDVWDPFQGFP-SGPS 35 >gb|AAA61632.1| low molecular weight heat-shock protein [Papaver somniferum] Length = 210 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 129 MSLIPSFFGNRRSNVFDPLSLDIWDPFQGFPLSS 230 MS+IPSFF N+RSNVFDP SLDIWDPFQGFP S+ Sbjct: 1 MSIIPSFFSNQRSNVFDPFSLDIWDPFQGFPFST 34 >gb|ADM47405.1| small molecular heat shock protein [Nicotiana tabacum] Length = 159 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 129 MSLIPSFFGNRRSNVFDPLSLDIWDPFQGFPLS 227 MSLIPSFFG RRSN+FDP SLD+WDPF+GFP S Sbjct: 1 MSLIPSFFGGRRSNIFDPFSLDLWDPFEGFPFS 33