BLASTX nr result
ID: Scutellaria23_contig00012026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00012026 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529755.1| glutathione peroxidase, putative [Ricinus co... 157 9e-37 gb|AAL40914.1| phospholipid hydroperoxide glutathione peroxidase... 155 4e-36 ref|XP_002310444.1| glutathione peroxidase [Populus trichocarpa]... 154 9e-36 gb|AEA86293.1| glutathione peroxidase [Solanum nigrum] 152 3e-35 gb|AEG64804.1| putative glutathione peroxidase [Jatropha curcas] 150 8e-35 >ref|XP_002529755.1| glutathione peroxidase, putative [Ricinus communis] gi|223530753|gb|EEF32621.1| glutathione peroxidase, putative [Ricinus communis] Length = 167 Score = 157 bits (397), Expect = 9e-37 Identities = 76/92 (82%), Positives = 82/92 (89%) Frame = -2 Query: 295 FGFQEPGTNEEIQESACTRFKAEFPIFDKIEVNGKNTSPLYKFLKSEKGGLFVNAIKWNF 116 F QEPG+NEEIQE ACT FKAEFPIFDKIEVNGKNT+PLYK+LKSEKGG F +AIKWNF Sbjct: 73 FAGQEPGSNEEIQEVACTMFKAEFPIFDKIEVNGKNTAPLYKYLKSEKGGYFGDAIKWNF 132 Query: 115 TKFLVSKEGKVVRRYAPTTPPLAIEKDVQILL 20 TKFLV+KEGKVV RYAPTT PL IEKD+Q LL Sbjct: 133 TKFLVNKEGKVVERYAPTTSPLKIEKDIQNLL 164 >gb|AAL40914.1| phospholipid hydroperoxide glutathione peroxidase [Momordica charantia] Length = 167 Score = 155 bits (391), Expect = 4e-36 Identities = 72/92 (78%), Positives = 82/92 (89%) Frame = -2 Query: 295 FGFQEPGTNEEIQESACTRFKAEFPIFDKIEVNGKNTSPLYKFLKSEKGGLFVNAIKWNF 116 F QEPGTNEEIQE+ CTRFKAEFPIFDK+EVNGKN +P+YKFLK +KGG+F + IKWNF Sbjct: 73 FARQEPGTNEEIQETLCTRFKAEFPIFDKVEVNGKNAAPIYKFLKLKKGGIFGDGIKWNF 132 Query: 115 TKFLVSKEGKVVRRYAPTTPPLAIEKDVQILL 20 TKFLV++EGKVV RYAPTTPPL IEKD+Q LL Sbjct: 133 TKFLVNREGKVVDRYAPTTPPLNIEKDIQNLL 164 >ref|XP_002310444.1| glutathione peroxidase [Populus trichocarpa] gi|222853347|gb|EEE90894.1| glutathione peroxidase [Populus trichocarpa] Length = 167 Score = 154 bits (388), Expect = 9e-36 Identities = 73/92 (79%), Positives = 82/92 (89%) Frame = -2 Query: 295 FGFQEPGTNEEIQESACTRFKAEFPIFDKIEVNGKNTSPLYKFLKSEKGGLFVNAIKWNF 116 F QEPG+NEEIQ++ CT FKAEFPIFDKI+VNGKNT+P+YKFLKSEKGG F +AIKWNF Sbjct: 73 FAGQEPGSNEEIQDTVCTIFKAEFPIFDKIDVNGKNTAPVYKFLKSEKGGYFGDAIKWNF 132 Query: 115 TKFLVSKEGKVVRRYAPTTPPLAIEKDVQILL 20 TKFLV+KEGKVV RYAPTT PL IEKD+Q LL Sbjct: 133 TKFLVNKEGKVVERYAPTTSPLKIEKDIQNLL 164 >gb|AEA86293.1| glutathione peroxidase [Solanum nigrum] Length = 109 Score = 152 bits (384), Expect = 3e-35 Identities = 70/92 (76%), Positives = 80/92 (86%) Frame = -2 Query: 295 FGFQEPGTNEEIQESACTRFKAEFPIFDKIEVNGKNTSPLYKFLKSEKGGLFVNAIKWNF 116 F +QEPGTNEEIQ++ CTRFKAEFP+F+KI+VNG N +PLYKFLKSEKGG NA+KWNF Sbjct: 15 FLWQEPGTNEEIQQTVCTRFKAEFPVFEKIDVNGDNVAPLYKFLKSEKGGFLGNAVKWNF 74 Query: 115 TKFLVSKEGKVVRRYAPTTPPLAIEKDVQILL 20 TKFLV+KEGKVV RYAP TPPL EKD+Q LL Sbjct: 75 TKFLVNKEGKVVERYAPKTPPLQFEKDIQNLL 106 >gb|AEG64804.1| putative glutathione peroxidase [Jatropha curcas] Length = 167 Score = 150 bits (380), Expect = 8e-35 Identities = 71/92 (77%), Positives = 82/92 (89%) Frame = -2 Query: 295 FGFQEPGTNEEIQESACTRFKAEFPIFDKIEVNGKNTSPLYKFLKSEKGGLFVNAIKWNF 116 F QEPG +++IQE+ACT FKAEFPIFDKIEVNGKN++PLYK+LKSEKGG+F +AIKWNF Sbjct: 73 FAGQEPGDSDKIQETACTLFKAEFPIFDKIEVNGKNSAPLYKYLKSEKGGIFGDAIKWNF 132 Query: 115 TKFLVSKEGKVVRRYAPTTPPLAIEKDVQILL 20 TKFLV+KEGK V RYAPTT PL IEKD+Q LL Sbjct: 133 TKFLVNKEGKTVERYAPTTSPLKIEKDIQNLL 164