BLASTX nr result
ID: Scutellaria23_contig00011751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00011751 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38567.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002278113.1| PREDICTED: structural maintenance of chromos... 67 2e-09 ref|XP_002510971.1| structural maintenance of chromosomes 6 smc6... 67 2e-09 ref|XP_002462109.1| hypothetical protein SORBIDRAFT_02g019360 [S... 66 3e-09 ref|NP_001169562.1| uncharacterized protein LOC100383441 [Zea ma... 66 3e-09 >emb|CBI38567.3| unnamed protein product [Vitis vinifera] Length = 1027 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 1 FALSHGSQWIFITPHDISMVKHDERIKKQQMAAPR 105 FAL+ GSQWIFITPHDISMVK ERIKKQQMAAPR Sbjct: 992 FALAQGSQWIFITPHDISMVKQGERIKKQQMAAPR 1026 >ref|XP_002278113.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Vitis vinifera] Length = 1057 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 1 FALSHGSQWIFITPHDISMVKHDERIKKQQMAAPR 105 FAL+ GSQWIFITPHDISMVK ERIKKQQMAAPR Sbjct: 1022 FALAQGSQWIFITPHDISMVKQGERIKKQQMAAPR 1056 >ref|XP_002510971.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] gi|223550086|gb|EEF51573.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] Length = 1058 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 1 FALSHGSQWIFITPHDISMVKHDERIKKQQMAAPR 105 FAL+ GSQWIFITPHDISMVK ERIKKQQMAAPR Sbjct: 1023 FALAQGSQWIFITPHDISMVKQGERIKKQQMAAPR 1057 >ref|XP_002462109.1| hypothetical protein SORBIDRAFT_02g019360 [Sorghum bicolor] gi|241925486|gb|EER98630.1| hypothetical protein SORBIDRAFT_02g019360 [Sorghum bicolor] Length = 1039 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 FALSHGSQWIFITPHDISMVKHDERIKKQQMAAPRG 108 FA++ GSQWIFITPHDISMVK +RIKKQQMAAPRG Sbjct: 1004 FAVTQGSQWIFITPHDISMVKAGDRIKKQQMAAPRG 1039 >ref|NP_001169562.1| uncharacterized protein LOC100383441 [Zea mays] gi|224030099|gb|ACN34125.1| unknown [Zea mays] gi|414884905|tpg|DAA60919.1| TPA: hypothetical protein ZEAMMB73_860226 [Zea mays] Length = 1040 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 FALSHGSQWIFITPHDISMVKHDERIKKQQMAAPRG 108 FA++ GSQWIFITPHDISMVK +RIKKQQMAAPRG Sbjct: 1005 FAVAQGSQWIFITPHDISMVKAGDRIKKQQMAAPRG 1040