BLASTX nr result
ID: Scutellaria23_contig00011357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00011357 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001235906.1| uncharacterized protein LOC100305730 [Glycin... 117 1e-24 ref|XP_002271111.1| PREDICTED: uncharacterized protein LOC100251... 116 2e-24 sp|O03992.1|TCTP_FRAAN RecName: Full=Translationally-controlled ... 115 3e-24 gb|ABW16955.1| translationally controlled tumor protein [Salvia ... 114 8e-24 gb|AEO33636.1| hypothetical protein [Amblyomma maculatum] 113 1e-23 >ref|NP_001235906.1| uncharacterized protein LOC100305730 [Glycine max] gi|255626449|gb|ACU13569.1| unknown [Glycine max] Length = 168 Score = 117 bits (293), Expect = 1e-24 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +3 Query: 3 EEDEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFIAYIKKYIKLLSAKLEGEQQEQFKKTI 182 +EDEGVDDQ VKVVDIVDTFRLQEQPPFDKKQFI Y+K+YIKLL+AKLEGEQQE FKK I Sbjct: 55 DEDEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFITYMKRYIKLLTAKLEGEQQELFKKHI 114 Query: 183 EGATK 197 EGATK Sbjct: 115 EGATK 119 >ref|XP_002271111.1| PREDICTED: uncharacterized protein LOC100251175 isoform 1 [Vitis vinifera] gi|147837146|emb|CAN63631.1| hypothetical protein VITISV_009947 [Vitis vinifera] gi|297736844|emb|CBI26045.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 116 bits (291), Expect = 2e-24 Identities = 54/65 (83%), Positives = 62/65 (95%) Frame = +3 Query: 6 EDEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFIAYIKKYIKLLSAKLEGEQQEQFKKTIE 185 E+EGVDDQTVKVVDIVDTFRLQEQPPFDKKQF+ Y+K+YIKLL+ KLEGE+QE+FKK IE Sbjct: 55 EEEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFVTYMKRYIKLLTPKLEGEKQEEFKKNIE 114 Query: 186 GATKY 200 GATK+ Sbjct: 115 GATKF 119 >sp|O03992.1|TCTP_FRAAN RecName: Full=Translationally-controlled tumor protein homolog; Short=TCTP gi|1922278|emb|CAB06695.1| TCTP protein [Fragaria x ananassa] Length = 170 Score = 115 bits (289), Expect = 3e-24 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = +3 Query: 3 EEDEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFIAYIKKYIKLLSAKLEGEQQEQFKKTI 182 + DEGVDDQTVKVVDIVDTFRLQEQPPFDKKQF+ ++K+YIKLL+ KLEGEQQE FKK I Sbjct: 57 DADEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFVTWVKRYIKLLTPKLEGEQQETFKKNI 116 Query: 183 EGATKY 200 EGATK+ Sbjct: 117 EGATKF 122 >gb|ABW16955.1| translationally controlled tumor protein [Salvia miltiorrhiza] Length = 168 Score = 114 bits (285), Expect = 8e-24 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +3 Query: 6 EDEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFIAYIKKYIKLLSAKLEGEQQEQFKKTIE 185 EDEGVDDQ VKVVDIVDTFRLQEQPPFDKKQFI YIKKYIK L+ KL+ E+Q++FKK+IE Sbjct: 56 EDEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFIGYIKKYIKTLTPKLDAEKQDEFKKSIE 115 Query: 186 GATKY 200 GATKY Sbjct: 116 GATKY 120 >gb|AEO33636.1| hypothetical protein [Amblyomma maculatum] Length = 191 Score = 113 bits (283), Expect = 1e-23 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = +3 Query: 3 EEDEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFIAYIKKYIKLLSAKLEGEQQEQFKKTI 182 +E+EGVDDQ VKVVDIVDTFRLQEQPPFDKKQF+ YIK+YIKLLS+KL+ E+QE FKK I Sbjct: 88 DEEEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFVTYIKRYIKLLSSKLDAEKQELFKKNI 147 Query: 183 EGATKY 200 EGATK+ Sbjct: 148 EGATKF 153