BLASTX nr result
ID: Scutellaria23_contig00011257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00011257 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADM47405.1| small molecular heat shock protein [Nicotiana tab... 74 1e-11 gb|AAQ19680.1| chloroplast small heat shock protein class I [Cap... 74 1e-11 gb|ADU55789.1| HSP18.1A [Citrullus lanatus] 74 1e-11 gb|ADU55794.1| HSP18.1B [Citrullus lanatus] 74 2e-11 ref|XP_004162776.1| PREDICTED: 18.2 kDa class I heat shock prote... 73 2e-11 >gb|ADM47405.1| small molecular heat shock protein [Nicotiana tabacum] Length = 159 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 3/46 (6%) Frame = +1 Query: 154 MSLIPSFFGNRRSNVFDPFSLDIWDPFQDFPLS---SNLPSSARET 282 MSLIPSFFG RRSN+FDPFSLD+WDPF+ FP S +N P+SARET Sbjct: 1 MSLIPSFFGGRRSNIFDPFSLDLWDPFEGFPFSRTVANTPTSARET 46 >gb|AAQ19680.1| chloroplast small heat shock protein class I [Capsicum frutescens] Length = 159 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%) Frame = +1 Query: 154 MSLIPSFFGNRRSNVFDPFSLDIWDPFQDFPLSS---NLPSSARETT 285 MS+IPSFFG RRSN+FDP SLD+WDPF+ FP+SS N PSSARET+ Sbjct: 1 MSMIPSFFGGRRSNIFDPVSLDLWDPFEGFPISSTIANTPSSARETS 47 >gb|ADU55789.1| HSP18.1A [Citrullus lanatus] Length = 159 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 3/47 (6%) Frame = +1 Query: 154 MSLIPSFFGNRRSNVFDPFSLDIWDPFQDFPLS---SNLPSSARETT 285 M+LIP+ FG RRSNVFDPFSLD+WDPF+ FP S +NLPSSARET+ Sbjct: 1 MALIPTIFGGRRSNVFDPFSLDVWDPFEGFPFSNSLANLPSSARETS 47 >gb|ADU55794.1| HSP18.1B [Citrullus lanatus] Length = 159 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +1 Query: 154 MSLIPSFFGNRRSNVFDPFSLDIWDPFQDFPLS---SNLPSSARETT 285 MSLIPSFFG RRSNVFDPFSLD+WDPF+ FP +NLPSSA ET+ Sbjct: 1 MSLIPSFFGGRRSNVFDPFSLDLWDPFEGFPFPTTLANLPSSALETS 47 >ref|XP_004162776.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Cucumis sativus] Length = 159 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +1 Query: 154 MSLIPSFFGNRRSNVFDPFSLDIWDPFQDFPLS---SNLPSSARETT 285 M+L+PS FG RRSNVFDPFSLDIWDPF+ FP S +N PSSARET+ Sbjct: 1 MALVPSIFGGRRSNVFDPFSLDIWDPFEGFPFSNSLANAPSSARETS 47