BLASTX nr result
ID: Scutellaria23_contig00010787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00010787 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW89467.1| low molecular weight heat shock protein [Gossypiu... 117 7e-25 gb|ADM47405.1| small molecular heat shock protein [Nicotiana tab... 116 2e-24 ref|XP_003519372.1| PREDICTED: 18.2 kDa class I heat shock prote... 113 1e-23 gb|AAQ19680.1| chloroplast small heat shock protein class I [Cap... 113 1e-23 emb|CAA50022.1| Nthsp18p [Nicotiana tabacum] 112 2e-23 >gb|ABW89467.1| low molecular weight heat shock protein [Gossypium hirsutum] Length = 158 Score = 117 bits (294), Expect = 7e-25 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 5/73 (6%) Frame = +2 Query: 65 MSLIPSFFGNRRSNVFDPFSLDIWDPFQGFPLSSPS-----AGETTALANARIDWKETPE 229 MSLIPSFFGNRRS+ FDPFSLD+WDPF+ FP SSPS + ET+A N RIDWKETPE Sbjct: 1 MSLIPSFFGNRRSSAFDPFSLDVWDPFKDFPFSSPSSLSTGSSETSAFVNTRIDWKETPE 60 Query: 230 SHVFKVDVPGLKK 268 SHVFK DVPGLKK Sbjct: 61 SHVFKADVPGLKK 73 >gb|ADM47405.1| small molecular heat shock protein [Nicotiana tabacum] Length = 159 Score = 116 bits (291), Expect = 2e-24 Identities = 55/74 (74%), Positives = 61/74 (82%), Gaps = 6/74 (8%) Frame = +2 Query: 65 MSLIPSFFGNRRSNVFDPFSLDIWDPFQGFPLS------SPSAGETTALANARIDWKETP 226 MSLIPSFFG RRSN+FDPFSLD+WDPF+GFP S SA ET A A+ARIDWKETP Sbjct: 1 MSLIPSFFGGRRSNIFDPFSLDLWDPFEGFPFSRTVANTPTSARETAAFASARIDWKETP 60 Query: 227 ESHVFKVDVPGLKK 268 ESHVFKVD+PG+KK Sbjct: 61 ESHVFKVDLPGIKK 74 >ref|XP_003519372.1| PREDICTED: 18.2 kDa class I heat shock protein [Glycine max] Length = 153 Score = 113 bits (283), Expect = 1e-23 Identities = 47/68 (69%), Positives = 60/68 (88%) Frame = +2 Query: 65 MSLIPSFFGNRRSNVFDPFSLDIWDPFQGFPLSSPSAGETTALANARIDWKETPESHVFK 244 MS+IP+ FG RRSNVFDP SLD+WDP +GFP S+ +AGE++A+AN R+DWKETP++HVF Sbjct: 1 MSIIPNLFGGRRSNVFDPVSLDVWDPLEGFPFSTANAGESSAIANTRVDWKETPQAHVFS 60 Query: 245 VDVPGLKK 268 VD+PGLKK Sbjct: 61 VDLPGLKK 68 >gb|AAQ19680.1| chloroplast small heat shock protein class I [Capsicum frutescens] Length = 159 Score = 113 bits (283), Expect = 1e-23 Identities = 51/74 (68%), Positives = 62/74 (83%), Gaps = 6/74 (8%) Frame = +2 Query: 65 MSLIPSFFGNRRSNVFDPFSLDIWDPFQGFPLSS------PSAGETTALANARIDWKETP 226 MS+IPSFFG RRSN+FDP SLD+WDPF+GFP+SS SA ET+A NARIDWKETP Sbjct: 1 MSMIPSFFGGRRSNIFDPVSLDLWDPFEGFPISSTIANTPSSARETSAFPNARIDWKETP 60 Query: 227 ESHVFKVDVPGLKK 268 ++H+FKVDVPG+K+ Sbjct: 61 QAHIFKVDVPGIKR 74 >emb|CAA50022.1| Nthsp18p [Nicotiana tabacum] Length = 159 Score = 112 bits (281), Expect = 2e-23 Identities = 52/74 (70%), Positives = 62/74 (83%), Gaps = 6/74 (8%) Frame = +2 Query: 65 MSLIPSFFGNRRSNVFDPFSLDIWDPFQGFPLSS------PSAGETTALANARIDWKETP 226 M++IPSFFG RRSN+FDPFSLDI+DPF+GFP S SA ET+A ANARIDWKETP Sbjct: 1 MAMIPSFFGGRRSNIFDPFSLDIFDPFEGFPFSGTVANVPSSARETSAFANARIDWKETP 60 Query: 227 ESHVFKVDVPGLKK 268 +SH+FK+DVPG+KK Sbjct: 61 DSHIFKMDVPGIKK 74