BLASTX nr result
ID: Scutellaria23_contig00010772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00010772 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] 89 3e-16 ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355... 87 1e-15 gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] 86 2e-15 gb|AAG09208.1|AF175278_1 wound-inducible P450 hydroxylase [Pisum... 86 4e-15 sp|Q43068.2|C82A1_PEA RecName: Full=Cytochrome P450 82A1; AltNam... 86 4e-15 >gb|AGF30364.1| CYP450 monooxygenase CYP82D33 [Ocimum basilicum] Length = 534 Score = 89.4 bits (220), Expect = 3e-16 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 4/75 (5%) Frame = -3 Query: 217 WSDDALEFKPQRFF--DKKVAVKGQDFELMPFGGGRRMCPGSNLGMHMVHFVLANILQAF 44 WSD LEF+P+RF DK VKGQDFEL+PFG GRR+CPG + G+ M+H VLA++LQAF Sbjct: 430 WSDP-LEFRPERFLAGDKTFDVKGQDFELIPFGAGRRICPGLSFGLQMLHLVLASLLQAF 488 Query: 43 DITTGS--TVDMTES 5 D++T S VDM+ES Sbjct: 489 DMSTVSDEAVDMSES 503 >ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula] gi|355493360|gb|AES74563.1| Cytochrome P450 [Medicago truncatula] Length = 524 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/73 (57%), Positives = 53/73 (72%), Gaps = 4/73 (5%) Frame = -3 Query: 208 DALEFKPQRFFD--KKVAVKGQDFELMPFGGGRRMCPGSNLGMHMVHFVLANILQAFDIT 35 D LEFKP+RF K V KGQ FEL+PFG GRR+CPG + G+HM+H LAN L +F+I Sbjct: 426 DPLEFKPERFLTTHKNVDAKGQHFELLPFGSGRRICPGISFGLHMIHLTLANFLHSFEIV 485 Query: 34 TGST--VDMTESV 2 GS+ VDMTE++ Sbjct: 486 NGSSEPVDMTENL 498 >gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita] Length = 516 Score = 86.3 bits (212), Expect = 2e-15 Identities = 41/75 (54%), Positives = 58/75 (77%), Gaps = 4/75 (5%) Frame = -3 Query: 217 WSDDALEFKPQRFF--DKKVAVKGQDFELMPFGGGRRMCPGSNLGMHMVHFVLANILQAF 44 WSD + EF+P+RF +K + VKGQDFEL+PF GRR+CPG+N G+ M+H VLA++LQAF Sbjct: 418 WSDPS-EFRPERFLNGEKSMDVKGQDFELIPFSAGRRICPGTNFGLQMLHLVLASLLQAF 476 Query: 43 DIT--TGSTVDMTES 5 D++ + +DM+ES Sbjct: 477 DLSRVSNEEIDMSES 491 >gb|AAG09208.1|AF175278_1 wound-inducible P450 hydroxylase [Pisum sativum] Length = 540 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/71 (57%), Positives = 54/71 (76%), Gaps = 4/71 (5%) Frame = -3 Query: 208 DALEFKPQRFFD--KKVAVKGQDFELMPFGGGRRMCPGSNLGMHMVHFVLANILQAFDIT 35 D LEFKP+RF K V V+GQ+FEL+PFG GRRMC G +LG+HMVH++LAN L +F+I Sbjct: 442 DPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSLGLHMVHYILANFLHSFEIL 501 Query: 34 TGS--TVDMTE 8 S ++D+TE Sbjct: 502 NPSPESIDVTE 512 >sp|Q43068.2|C82A1_PEA RecName: Full=Cytochrome P450 82A1; AltName: Full=CYPLXXXII gi|4874244|gb|AAC49188.2| cytochrome P450 monooxygenase [Pisum sativum] Length = 544 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/71 (57%), Positives = 54/71 (76%), Gaps = 4/71 (5%) Frame = -3 Query: 208 DALEFKPQRFFD--KKVAVKGQDFELMPFGGGRRMCPGSNLGMHMVHFVLANILQAFDIT 35 D LEFKP+RF K V V+GQ+FEL+PFG GRRMC G +LG+HMVH++LAN L +F+I Sbjct: 446 DPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSLGLHMVHYILANFLHSFEIL 505 Query: 34 TGS--TVDMTE 8 S ++D+TE Sbjct: 506 NPSPESIDVTE 516