BLASTX nr result
ID: Scutellaria23_contig00010757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00010757 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propio... 141 5e-32 ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyce... 119 3e-25 ref|ZP_06913011.1| conserved hypothetical protein [Streptomyces ... 115 4e-24 ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces ... 115 4e-24 ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces ... 115 4e-24 >ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] gi|313773062|gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 141 bits (356), Expect = 5e-32 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = -3 Query: 208 GGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRS 29 GGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRS Sbjct: 42 GGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRS 101 Query: 28 ATLR 17 ATLR Sbjct: 102 ATLR 105 >ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] gi|153799348|gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 119 bits (298), Expect = 3e-25 Identities = 59/70 (84%), Positives = 61/70 (87%) Frame = -1 Query: 210 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDPMKSESLVIAD 31 KVGMTS+HHAPYV GFTHATMAGTE + VR SES KA LSSDWGLQLDPMK ESLVIAD Sbjct: 8 KVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVESLVIAD 67 Query: 30 QQRCGEYVPG 1 QQRCGEYV G Sbjct: 68 QQRCGEYVLG 77 >ref|ZP_06913011.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152875|gb|EFH32042.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 121 Score = 115 bits (288), Expect = 4e-24 Identities = 58/70 (82%), Positives = 60/70 (85%) Frame = -1 Query: 210 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDPMKSESLVIAD 31 KVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLDPMKSE LVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIAD 73 Query: 30 QQRCGEYVPG 1 Q CGEYVPG Sbjct: 74 QHCCGEYVPG 83 >ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151805|gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 115 bits (288), Expect = 4e-24 Identities = 58/70 (82%), Positives = 60/70 (85%) Frame = -1 Query: 210 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDPMKSESLVIAD 31 KVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLDPMKSE LVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIAD 73 Query: 30 QQRCGEYVPG 1 Q CGEYVPG Sbjct: 74 QHCCGEYVPG 83 >ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces sp. e14] gi|292833485|gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 115 bits (288), Expect = 4e-24 Identities = 58/70 (82%), Positives = 60/70 (85%) Frame = -1 Query: 210 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDPMKSESLVIAD 31 KVG TSSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQLDPMKSESLVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIAD 73 Query: 30 QQRCGEYVPG 1 Q CGEYVPG Sbjct: 74 QHCCGEYVPG 83