BLASTX nr result
ID: Scutellaria23_contig00009116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00009116 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510206.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002510206.1| conserved hypothetical protein [Ricinus communis] gi|223550907|gb|EEF52393.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 55.8 bits (133), Expect = 4e-06 Identities = 31/70 (44%), Positives = 42/70 (60%) Frame = +3 Query: 21 ESPAVKALGPLFKLTEVQLWDDGSTEVQELPHFQESIILSNGDEDYGRGDYASTNGICSI 200 E A++ALG LFKLTEV +W+DGSTE +E+ F ES ++ +D T + Sbjct: 4 EGHAIRALGSLFKLTEVYIWEDGSTETREICLFPES---TSDYDDTSSNITDLTRDFSEV 60 Query: 201 SEDLEVTKQM 230 E LE+TKQM Sbjct: 61 PEGLELTKQM 70