BLASTX nr result
ID: Scutellaria23_contig00007831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00007831 (557 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 100 2e-19 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 97 1e-18 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 95 8e-18 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|1... 91 9e-17 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +2 Query: 89 MFPGMFMRKPDKAAAIKQLKSHVAMFGVWVTVIRVTPYILHYFSDQNEELKLE 247 MFPGMFMRKPDKAAA+KQL+SHVAMFGVWV VIRVTPY+LHY SD+ EELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLD 53 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 97.4 bits (241), Expect = 1e-18 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +2 Query: 89 MFPGMFMRKPDKAAAIKQLKSHVAMFGVWVTVIRVTPYILHYFSDQNEELKLE 247 MFPGMFMRKPDKA A+KQLKSHVAMFG WV V+RVTPY+LHY SD+ +ELKLE Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLE 53 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 94.7 bits (234), Expect = 8e-18 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +2 Query: 89 MFPGMFMRKPDKAAAIKQLKSHVAMFGVWVTVIRVTPYILHYFSDQNEELKLEL 250 MFPGMFMRKPDKAAA+KQLKSH AMFG WV VIRVTPY+LH+ + EELKLEL Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLEL 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 92.8 bits (229), Expect = 3e-17 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = +2 Query: 89 MFPGMFMRKPDKAAAIKQLKSHVAMFGVWVTVIRVTPYILHYFSDQNEELKLE 247 MFPGMFMRKPDKAAA+KQLK+H A+FG WV +IRVTPY+LHY SD +ELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLD 53 >ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| predicted protein [Populus trichocarpa] Length = 54 Score = 91.3 bits (225), Expect = 9e-17 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = +2 Query: 89 MFPGMFMRKPDKAAAIKQLKSHVAMFGVWVTVIRVTPYILHYFSDQNEELKLE 247 MFPG+FM+KPDKA A+KQL+SHVAMFG WV V+RVTPY+LHY S + +ELKLE Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLE 53