BLASTX nr result
ID: Scutellaria23_contig00007803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00007803 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520976.1| DNA binding protein, putative [Ricinus commu... 56 3e-06 >ref|XP_002520976.1| DNA binding protein, putative [Ricinus communis] gi|223539813|gb|EEF41393.1| DNA binding protein, putative [Ricinus communis] Length = 299 Score = 56.2 bits (134), Expect = 3e-06 Identities = 36/82 (43%), Positives = 42/82 (51%) Frame = -2 Query: 355 MANNPGETPSDDFLEQILGYPSYASAGDASNLVGNDAPSAAMMLQLGXXXXXXXXXXXXX 176 MANNP E P+DDFL++ILG P++ASA DA+ LVG D A Sbjct: 1 MANNPTEPPADDFLQEILGLPNFASA-DAAGLVGADGALAT------------------- 40 Query: 175 XXXXXXXXXMMLQLGSGDGSAH 110 MMLQL SGDGS H Sbjct: 41 --------PMMLQLSSGDGSNH 54