BLASTX nr result
ID: Scutellaria23_contig00007481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00007481 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 116 RSLKQRSVQRCSKQMREHKARLYIIWRCTVLLLCWHE 226 RS+K RS QRCSKQ+RE + RLYIIWRCTV+LLCWH+ Sbjct: 28 RSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64