BLASTX nr result
ID: Scutellaria23_contig00007349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00007349 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago ... 60 1e-07 gb|AAT46037.1| At5g54075 [Arabidopsis thaliana] gi|50198954|gb|A... 55 6e-06 >ref|XP_003612435.1| hypothetical protein MTR_5g024980 [Medicago truncatula] gi|355513770|gb|AES95393.1| hypothetical protein MTR_5g024980 [Medicago truncatula] Length = 286 Score = 60.5 bits (145), Expect = 1e-07 Identities = 37/70 (52%), Positives = 43/70 (61%) Frame = +2 Query: 170 RERSSTAPRVQGSEPRVLLITLWSSSLIHQTWFPVSLEIKDTEVRSYRTDPVQVRLFAIM 349 RERSSTA V + S IHQT+ PVSLEIKDT VRSYRTDPVQVR I+ Sbjct: 12 RERSSTAEDDAHIILAVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQVRSCLIV 71 Query: 350 FMYNKCILAI 379 ++K A+ Sbjct: 72 LSFSKTKAAL 81 >gb|AAT46037.1| At5g54075 [Arabidopsis thaliana] gi|50198954|gb|AAT70480.1| At5g54075 [Arabidopsis thaliana] Length = 39 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 352 KHYGKQPYLNRICSIGSYLCILDF*GDRKPSLVDE 248 KH+ +PYLNRICSIGSYLC LDF DR +LVDE Sbjct: 4 KHHWSRPYLNRICSIGSYLCFLDFSRDRPLTLVDE 38