BLASTX nr result
ID: Scutellaria23_contig00007222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00007222 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635090.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-20 emb|CBI38358.3| unnamed protein product [Vitis vinifera] 102 3e-20 emb|CAN61826.1| hypothetical protein VITISV_027628 [Vitis vinifera] 102 3e-20 ref|XP_003516589.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-18 ref|XP_004171057.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 >ref|XP_003635090.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 616 Score = 102 bits (255), Expect = 3e-20 Identities = 46/94 (48%), Positives = 68/94 (72%) Frame = +1 Query: 1 HDAISLSKLISFAALSSSGDLLYALYLFEEIPQPNRHMYNTLIRAFSSGKYSDKSILLYQ 180 ++ ++L KLISF A+ +GDL YA +F++IPQPN+ MYN+LIR +S+ ++LL++ Sbjct: 18 NETLTLGKLISFCAVDDAGDLQYAQRMFDQIPQPNKFMYNSLIRGYSNSDDPIDAVLLFR 77 Query: 181 KMLSGGIFPNEFTFPFVLKACAFRKAYLKGVSVH 282 +M+ G+ PNEFT PFVLKAC + AY + V VH Sbjct: 78 RMICSGLSPNEFTLPFVLKACGCKSAYWEAVLVH 111 >emb|CBI38358.3| unnamed protein product [Vitis vinifera] Length = 549 Score = 102 bits (255), Expect = 3e-20 Identities = 46/94 (48%), Positives = 68/94 (72%) Frame = +1 Query: 1 HDAISLSKLISFAALSSSGDLLYALYLFEEIPQPNRHMYNTLIRAFSSGKYSDKSILLYQ 180 ++ ++L KLISF A+ +GDL YA +F++IPQPN+ MYN+LIR +S+ ++LL++ Sbjct: 18 NETLTLGKLISFCAVDDAGDLQYAQRMFDQIPQPNKFMYNSLIRGYSNSDDPIDAVLLFR 77 Query: 181 KMLSGGIFPNEFTFPFVLKACAFRKAYLKGVSVH 282 +M+ G+ PNEFT PFVLKAC + AY + V VH Sbjct: 78 RMICSGLSPNEFTLPFVLKACGCKSAYWEAVLVH 111 >emb|CAN61826.1| hypothetical protein VITISV_027628 [Vitis vinifera] Length = 688 Score = 102 bits (255), Expect = 3e-20 Identities = 46/94 (48%), Positives = 68/94 (72%) Frame = +1 Query: 1 HDAISLSKLISFAALSSSGDLLYALYLFEEIPQPNRHMYNTLIRAFSSGKYSDKSILLYQ 180 ++ ++L KLISF A+ +GDL YA +F++IPQPN+ MYN+LIR +S+ ++LL++ Sbjct: 144 NETLTLGKLISFCAVDDAGDLQYAQRMFDQIPQPNKFMYNSLIRGYSNSDDPIDAVLLFR 203 Query: 181 KMLSGGIFPNEFTFPFVLKACAFRKAYLKGVSVH 282 +M+ G+ PNEFT PFVLKAC + AY + V VH Sbjct: 204 RMICSGLSPNEFTLPFVLKACGCKSAYWEAVLVH 237 >ref|XP_003516589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Glycine max] Length = 667 Score = 94.7 bits (234), Expect = 7e-18 Identities = 47/91 (51%), Positives = 63/91 (69%) Frame = +1 Query: 10 ISLSKLISFAALSSSGDLLYALYLFEEIPQPNRHMYNTLIRAFSSGKYSDKSILLYQKML 189 ++L KL+S GDL YA LF++IPQPN+ MYN LIR +S+ KS+LL+++M+ Sbjct: 72 VTLGKLLSLCV--QEGDLRYAHLLFDQIPQPNKFMYNHLIRGYSNSNDPMKSLLLFRQMV 129 Query: 190 SGGIFPNEFTFPFVLKACAFRKAYLKGVSVH 282 S G PN+FTFPFVLKACA + Y + V VH Sbjct: 130 SAGPMPNQFTFPFVLKACAAKPFYWEAVIVH 160 >ref|XP_004171057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 415 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/91 (48%), Positives = 61/91 (67%) Frame = +1 Query: 10 ISLSKLISFAALSSSGDLLYALYLFEEIPQPNRHMYNTLIRAFSSGKYSDKSILLYQKML 189 I+L KLISF ++S GDL YA +F+ +PQPN+ M+N LIR +S+ + +I LY +M+ Sbjct: 21 ITLGKLISFCSVSQVGDLHYAHLVFDHLPQPNKFMFNCLIRGYSTSPHPINAIFLYVQMM 80 Query: 190 SGGIFPNEFTFPFVLKACAFRKAYLKGVSVH 282 G PN FT PFVLK+CA + AY + VH Sbjct: 81 RSGFLPNRFTLPFVLKSCASQLAYWEAFVVH 111