BLASTX nr result
ID: Scutellaria23_contig00006806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00006806 (557 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531043.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002531043.1| conserved hypothetical protein [Ricinus communis] gi|223529371|gb|EEF31336.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -2 Query: 517 NVESNSLVLRWKHMGDEEKKAAVTVEIQKLRRLPPNSAYASHRLKVLNKI 368 +V S L+W+H +EEKKA V E++++ +LP NS+YASHRL+VLNKI Sbjct: 3 DVASTQSKLQWQHRENEEKKAVVQEEMKRMNQLPANSSYASHRLRVLNKI 52