BLASTX nr result
ID: Scutellaria23_contig00006315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00006315 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323565.1| aquaporin, MIP family, PIP subfamily [Populu... 67 2e-09 ref|XP_002309126.1| aquaporin, MIP family, PIP subfamily [Populu... 67 2e-09 gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea] 66 3e-09 dbj|BAA22097.1| transmembrane protein [Arabidopsis thaliana] 66 3e-09 dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila] 66 3e-09 >ref|XP_002323565.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] gi|222868195|gb|EEF05326.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] Length = 287 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 268 WIFWVGPFIGAALASLYHQIVIRAIPFKSK 179 WIFWVGPFIGAALASLYHQIVIRAIPFKSK Sbjct: 258 WIFWVGPFIGAALASLYHQIVIRAIPFKSK 287 >ref|XP_002309126.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] gi|222855102|gb|EEE92649.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] Length = 287 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 268 WIFWVGPFIGAALASLYHQIVIRAIPFKSK 179 WIFWVGPFIGAALASLYHQIVIRAIPFKSK Sbjct: 258 WIFWVGPFIGAALASLYHQIVIRAIPFKSK 287 >gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea] Length = 286 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 268 WIFWVGPFIGAALASLYHQIVIRAIPFKSKA 176 WIFWVGPFIGAALA+LYHQIVIRAIPFKS+A Sbjct: 256 WIFWVGPFIGAALAALYHQIVIRAIPFKSRA 286 >dbj|BAA22097.1| transmembrane protein [Arabidopsis thaliana] Length = 287 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 268 WIFWVGPFIGAALASLYHQIVIRAIPFKSKA 176 WIFWVGPFIGAALA+LYHQIVIRAIPFKSK+ Sbjct: 257 WIFWVGPFIGAALAALYHQIVIRAIPFKSKS 287 >dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila] Length = 286 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 268 WIFWVGPFIGAALASLYHQIVIRAIPFKSKA 176 WIFWVGPFIGAALA+LYHQIVIRAIPFKSK+ Sbjct: 256 WIFWVGPFIGAALAALYHQIVIRAIPFKSKS 286