BLASTX nr result
ID: Scutellaria23_contig00004942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00004942 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus ... 60 2e-07 ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus ... 56 3e-06 ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box pro... 55 4e-06 >ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 464 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +3 Query: 57 LDKMRLDYVDWVNRVIALHKRPEIEEFRVFFDLTKTYQNTIDEWVRFALTKKVQKLELNL 236 LD R +V WVN+V+ H+ P +E R+ FDL + ID W+ A+ K+V++LE++L Sbjct: 96 LDMERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIAMQKRVKRLEIDL 155 Query: 237 TP-EPS 251 T EPS Sbjct: 156 TNIEPS 161 >ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 457 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/76 (34%), Positives = 50/76 (65%) Frame = +3 Query: 45 YDLRLDKMRLDYVDWVNRVIALHKRPEIEEFRVFFDLTKTYQNTIDEWVRFALTKKVQKL 224 + LR ++ R + WV RV+ ++K ++EF V FDLT + ++D+W+ FA++K +++L Sbjct: 78 FALRSERTR--FAMWVKRVLEVYKDSNLDEFIVSFDLTCNSRRSLDKWMNFAMSKTLKRL 135 Query: 225 ELNLTPEPSSRGLFNN 272 E++L P S + F++ Sbjct: 136 EISLAPFSSRKFRFHD 151 >ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] Length = 475 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/64 (40%), Positives = 39/64 (60%) Frame = +3 Query: 48 DLRLDKMRLDYVDWVNRVIALHKRPEIEEFRVFFDLTKTYQNTIDEWVRFALTKKVQKLE 227 D L R +V WVNRVI +K +E R+ F+L ++Q +D WV+FA+ K++ E Sbjct: 102 DENLKSERRQFVKWVNRVIDSYKGSNLETLRIRFNLDSSFQCDVDRWVQFAMQWKLKMFE 161 Query: 228 LNLT 239 LNL+ Sbjct: 162 LNLS 165