BLASTX nr result
ID: Scutellaria23_contig00004842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00004842 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 91 2e-16 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 88 1e-15 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 87 1e-15 gb|AFK44684.1| unknown [Lotus japonicus] 86 4e-15 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 86 5e-15 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = +3 Query: 111 KFVKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 248 KFVKEW TW KKAKVITHYGFIPLVIIIGMNS+PKPSLSQLLSPV Sbjct: 27 KFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356513233|ref|XP_003525318.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 117 VKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 248 +KEW+TWAM+KAKVITHYGFIPLVIIIGMNSDPKP LSQLLSPV Sbjct: 29 LKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356524002|ref|XP_003530622.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 117 VKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 248 +KEW+TWAM+KAKVITHYGFIPLVI+IGMNSDPKP LSQLLSPV Sbjct: 29 LKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 85.9 bits (211), Expect = 4e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 117 VKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 248 +KEW+TW M+KAKV+THYGFIPL+IIIGMNSDPKP LSQLLSPV Sbjct: 29 LKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 85.5 bits (210), Expect = 5e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +3 Query: 120 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 248 KEW+TWA+KKAKV+THYGFIPLVIIIGMNS+PKP LSQLLSPV Sbjct: 31 KEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73