BLASTX nr result
ID: Scutellaria23_contig00004113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00004113 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] 59 4e-07 >dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] Length = 364 Score = 58.9 bits (141), Expect = 4e-07 Identities = 39/119 (32%), Positives = 58/119 (48%), Gaps = 8/119 (6%) Frame = -1 Query: 344 WDMKRLKHLHVTNNDLLDV--------VGTLLPNLSTLLDVSVNSCTNGVFGRIPNLKKL 189 W+M RL+HLH ++ L + V + +L TL ++ SCT VF R PNLKKL Sbjct: 170 WNMARLRHLHTNSSAKLPLPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTPNLKKL 229 Query: 188 GIQIELMPDAVVPQRCFDHVSNLSELESLKCVVVNPTCNFVAPFVPLSVFPLNLKKLHL 12 GI+ ++ + +V L LE+LK + + P +FP L+KL L Sbjct: 230 GIRGKIAVLLEPNKSLLKNVKKLEYLENLKLINDSSQTGKGLRLPPSYIFPTKLRKLSL 288