BLASTX nr result
ID: Scutellaria23_contig00003873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00003873 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC39620.1| ferredoxin-thioredoxin-reductase catalytic subun... 88 8e-16 ref|XP_002883656.1| ferredoxin thioredoxin reductase catalytic b... 87 1e-15 ref|NP_178547.1| Ferredoxin-thioredoxin reductase catalytic chai... 87 1e-15 sp|P41349.1|FTRC2_SPIOL RecName: Full=Ferredoxin-thioredoxin red... 86 4e-15 dbj|BAD18925.1| ferredoxin [Codonopsis lanceolata] 85 5e-15 >emb|CAC39620.1| ferredoxin-thioredoxin-reductase catalytic subunit B [Solanum tuberosum] Length = 148 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 300 VAKVEPTEKSVEIMRKFSEQYARRSNTYFCVDKGVTSVVIKGLAEH 437 VAK+EP+EKSVEIMRKFSEQYARRS TYFC+DKGVTSVVIKGLAEH Sbjct: 33 VAKMEPSEKSVEIMRKFSEQYARRSETYFCMDKGVTSVVIKGLAEH 78 >ref|XP_002883656.1| ferredoxin thioredoxin reductase catalytic beta chain family protein [Arabidopsis lyrata subsp. lyrata] gi|297329496|gb|EFH59915.1| ferredoxin thioredoxin reductase catalytic beta chain family protein [Arabidopsis lyrata subsp. lyrata] Length = 146 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +3 Query: 303 AKVEPTEKSVEIMRKFSEQYARRSNTYFCVDKGVTSVVIKGLAEH 437 AK EP+EKSVEIMRKFSEQYARRS TYFCVDKGVTSVVIKGLAEH Sbjct: 32 AKTEPSEKSVEIMRKFSEQYARRSGTYFCVDKGVTSVVIKGLAEH 76 >ref|NP_178547.1| Ferredoxin-thioredoxin reductase catalytic chain [Arabidopsis thaliana] gi|75206241|sp|Q9SJ89.1|FTRC_ARATH RecName: Full=Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic; Short=FTR-C; Flags: Precursor gi|4544427|gb|AAD22336.1| putative ferredoxin-thioredoxin reductase [Arabidopsis thaliana] gi|17380642|gb|AAL36151.1| putative ferredoxin-thioredoxin reductase [Arabidopsis thaliana] gi|21436083|gb|AAM51242.1| putative ferredoxin-thioredoxin reductase [Arabidopsis thaliana] gi|21593637|gb|AAM65604.1| putative ferredoxin-thioredoxin reductase [Arabidopsis thaliana] gi|330250764|gb|AEC05858.1| Ferredoxin-thioredoxin reductase catalytic chain [Arabidopsis thaliana] Length = 146 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +3 Query: 303 AKVEPTEKSVEIMRKFSEQYARRSNTYFCVDKGVTSVVIKGLAEH 437 AK EP+EKSVEIMRKFSEQYARRS TYFCVDKGVTSVVIKGLAEH Sbjct: 32 AKTEPSEKSVEIMRKFSEQYARRSGTYFCVDKGVTSVVIKGLAEH 76 >sp|P41349.1|FTRC2_SPIOL RecName: Full=Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic; Short=FTR-C; AltName: Full=B1; AltName: Full=Ferredoxin-thioredoxin reductase subunit B; Short=FTR-B; Flags: Precursor gi|505189|emb|CAA54409.1| ferredoxin-thioredoxin reductase SU B [Spinacia oleracea] Length = 148 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 300 VAKVEPTEKSVEIMRKFSEQYARRSNTYFCVDKGVTSVVIKGLAEH 437 ++KVEP++KSVEIMRKFSEQYAR+S TYFCVDKGVTSVVIKGLAEH Sbjct: 33 LSKVEPSDKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLAEH 78 >dbj|BAD18925.1| ferredoxin [Codonopsis lanceolata] Length = 154 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +3 Query: 303 AKVEPTEKSVEIMRKFSEQYARRSNTYFCVDKGVTSVVIKGLAEH 437 AK EPT+KSVEIMRKFSEQYAR+S TYFCVDKGVTSVVIKGLA+H Sbjct: 40 AKAEPTQKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLADH 84