BLASTX nr result
ID: Scutellaria23_contig00003792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00003792 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509471.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002531718.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 ref|XP_002317499.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002305133.1| predicted protein [Populus trichocarpa] gi|1... 56 3e-06 ref|NP_001238727.1| uncharacterized protein LOC100305662 precurs... 55 4e-06 >ref|XP_002509471.1| conserved hypothetical protein [Ricinus communis] gi|223549370|gb|EEF50858.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 278 EVLGHDWVRLVVGDFAFGLSWLFFLIYSWRDKYD 177 +VL DW+R +VGDF LSW+FFL+YSWR+KYD Sbjct: 112 DVLAWDWLRQIVGDFLLALSWVFFLVYSWREKYD 145 >ref|XP_002531718.1| conserved hypothetical protein [Ricinus communis] gi|223528661|gb|EEF30677.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 278 EVLGHDWVRLVVGDFAFGLSWLFFLIYSWRDKYD 177 E L HD RLVVGD GLSW+FFL+YSWR+KYD Sbjct: 37 EDLAHDLPRLVVGDIVLGLSWVFFLVYSWREKYD 70 >ref|XP_002317499.1| predicted protein [Populus trichocarpa] gi|222860564|gb|EEE98111.1| predicted protein [Populus trichocarpa] Length = 144 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 278 EVLGHDWVRLVVGDFAFGLSWLFFLIYSWRDKYD 177 E L HD RLVVGD A LSW+FFL+YSWR+KYD Sbjct: 111 EDLAHDLPRLVVGDIALALSWVFFLVYSWREKYD 144 >ref|XP_002305133.1| predicted protein [Populus trichocarpa] gi|118484061|gb|ABK93916.1| unknown [Populus trichocarpa] gi|222848097|gb|EEE85644.1| predicted protein [Populus trichocarpa] Length = 143 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 278 EVLGHDWVRLVVGDFAFGLSWLFFLIYSWRDKYD 177 EVL DW+R VGD GLSW+ FL+YSWR+KYD Sbjct: 110 EVLAWDWLRQTVGDILLGLSWVLFLVYSWREKYD 143 >ref|NP_001238727.1| uncharacterized protein LOC100305662 precursor [Glycine max] gi|255626237|gb|ACU13463.1| unknown [Glycine max] Length = 150 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 278 EVLGHDWVRLVVGDFAFGLSWLFFLIYSWRDKYD 177 E L DW+R VGDF LSW+FFL+YSWR+KYD Sbjct: 117 EDLAWDWLRQTVGDFLLALSWVFFLVYSWREKYD 150