BLASTX nr result
ID: Scutellaria23_contig00003692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00003692 (720 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313262.1| predicted protein [Populus trichocarpa] gi|2... 57 6e-11 ref|XP_003623229.1| Pentatricopeptide repeat-containing protein ... 57 1e-10 ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containi... 50 4e-10 emb|CBI24253.3| unnamed protein product [Vitis vinifera] 50 4e-10 ref|XP_002526050.1| pentatricopeptide repeat-containing protein,... 52 8e-09 >ref|XP_002313262.1| predicted protein [Populus trichocarpa] gi|222849670|gb|EEE87217.1| predicted protein [Populus trichocarpa] Length = 559 Score = 56.6 bits (135), Expect(2) = 6e-11 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = +1 Query: 616 AKGIFNKMRVAGPTPTLSDYNTLMAALCRESSLEQ 720 AKG+F++M+++G +PTL DYNTLMA+LC+ESSLEQ Sbjct: 346 AKGLFSRMKISGLSPTLFDYNTLMASLCKESSLEQ 380 Score = 36.6 bits (83), Expect(2) = 6e-11 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 519 LWKEFLQLGLVPNSMTYSTLMSGLCRCNCI 608 LWK +LGLVP+S TYS ++ G C+ + + Sbjct: 314 LWKRVHKLGLVPSSTTYSVMIDGFCKMHML 343 >ref|XP_003623229.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498244|gb|AES79447.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 770 Score = 57.0 bits (136), Expect(2) = 1e-10 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 616 AKGIFNKMRVAGPTPTLSDYNTLMAALCRESSLEQ 720 AKG+FNK R +G PT+S+YNTLMA+LCRESS+EQ Sbjct: 500 AKGLFNKKRASGTRPTVSEYNTLMASLCRESSVEQ 534 Score = 35.0 bits (79), Expect(2) = 1e-10 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = +3 Query: 519 LWKEFLQLGLVPNSMTYSTLMSGLCRCNC------IFNSER 623 LWK+ + G+ PN+ TY+ L++GLC+ +FN +R Sbjct: 468 LWKDAVDSGISPNAATYTVLINGLCKMQMLSIAKGLFNKKR 508 >ref|XP_002276327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Vitis vinifera] Length = 728 Score = 49.7 bits (117), Expect(2) = 4e-10 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 616 AKGIFNKMRVAGPTPTLSDYNTLMAALCRESSLEQ 720 AKG+F +MR G P L DYNTLMA+LC+E SLEQ Sbjct: 515 AKGLFCEMRTHGLNPALFDYNTLMASLCKEGSLEQ 549 Score = 40.4 bits (93), Expect(2) = 4e-10 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +3 Query: 519 LWKEFLQLGLVPNSMTYSTLMSGLCR 596 LWK+ L LG VPNS TYS L+ G C+ Sbjct: 483 LWKQVLDLGFVPNSFTYSILIDGFCK 508 >emb|CBI24253.3| unnamed protein product [Vitis vinifera] Length = 582 Score = 49.7 bits (117), Expect(2) = 4e-10 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 616 AKGIFNKMRVAGPTPTLSDYNTLMAALCRESSLEQ 720 AKG+F +MR G P L DYNTLMA+LC+E SLEQ Sbjct: 369 AKGLFCEMRTHGLNPALFDYNTLMASLCKEGSLEQ 403 Score = 40.4 bits (93), Expect(2) = 4e-10 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +3 Query: 519 LWKEFLQLGLVPNSMTYSTLMSGLCR 596 LWK+ L LG VPNS TYS L+ G C+ Sbjct: 337 LWKQVLDLGFVPNSFTYSILIDGFCK 362 >ref|XP_002526050.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534631|gb|EEF36327.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 284 Score = 51.6 bits (122), Expect(2) = 8e-09 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +1 Query: 616 AKGIFNKMRVAGPTPTLSDYNTLMAALCRESSLEQ 720 AKG+F +MR G +P L DYN LMA+LC+ESSLEQ Sbjct: 65 AKGLFTRMRALGLSPALCDYNMLMASLCKESSLEQ 99 Score = 34.3 bits (77), Expect(2) = 8e-09 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 519 LWKEFLQLGLVPNSMTYSTLMSGLCR 596 +WK +LG VP+S+TY ++ G CR Sbjct: 33 IWKRVNELGFVPDSITYGAMIRGFCR 58