BLASTX nr result
ID: Scutellaria23_contig00003521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00003521 (699 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524858.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 ref|XP_002330690.1| predicted protein [Populus trichocarpa] gi|2... 68 2e-09 ref|XP_002277983.1| PREDICTED: uncharacterized protein LOC100252... 65 1e-08 ref|XP_002462669.1| hypothetical protein SORBIDRAFT_02g029940 [S... 63 6e-08 ref|XP_004171967.1| PREDICTED: uncharacterized LOC101217329 [Cuc... 62 1e-07 >ref|XP_002524858.1| conserved hypothetical protein [Ricinus communis] gi|223535821|gb|EEF37482.1| conserved hypothetical protein [Ricinus communis] Length = 141 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 333 EKKDPNVTGLAAKILASKKRKEAMKESITKLREKGKVVEEPSQ 461 EKKDPNV+G+ AK+LASKKRKEAMKESI KLREKGKVV+E S+ Sbjct: 91 EKKDPNVSGVQAKVLASKKRKEAMKESIAKLREKGKVVDEQSK 133 >ref|XP_002330690.1| predicted protein [Populus trichocarpa] gi|222872294|gb|EEF09425.1| predicted protein [Populus trichocarpa] Length = 129 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +3 Query: 333 EKKDPNVTGLAAKILASKKRKEAMKESITKLREKGKVVEEPSQ 461 EKKDP+++GL AK+LASKKRKEAMKE + ++REKGK V EPS+ Sbjct: 87 EKKDPSISGLQAKVLASKKRKEAMKEEVARIREKGKAVNEPSE 129 >ref|XP_002277983.1| PREDICTED: uncharacterized protein LOC100252564 [Vitis vinifera] gi|296084317|emb|CBI24705.3| unnamed protein product [Vitis vinifera] Length = 129 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/43 (65%), Positives = 39/43 (90%) Frame = +3 Query: 333 EKKDPNVTGLAAKILASKKRKEAMKESITKLREKGKVVEEPSQ 461 EK+DPN++G+ AK+LASKKRKEAMKE++ KLRE+GK + +PS+ Sbjct: 87 EKQDPNLSGVQAKVLASKKRKEAMKETMAKLREQGKAINQPSE 129 >ref|XP_002462669.1| hypothetical protein SORBIDRAFT_02g029940 [Sorghum bicolor] gi|241926046|gb|EER99190.1| hypothetical protein SORBIDRAFT_02g029940 [Sorghum bicolor] Length = 116 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = +3 Query: 333 EKKDPNVTGLAAKILASKKRKEAMKESITKLREKGKVVEE 452 EKKDPNV+G+ AK+LAS+KRKEAMKE++ KLRE+GK V++ Sbjct: 77 EKKDPNVSGVQAKVLASRKRKEAMKEAVAKLRERGKPVDK 116 >ref|XP_004171967.1| PREDICTED: uncharacterized LOC101217329 [Cucumis sativus] Length = 133 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 333 EKKDPNVTGLAAKILASKKRKEAMKESITKLREKGKVVEEP 455 EKKDPN++G+ AK+LASKKRKEA+KE+ KLR KGK V++P Sbjct: 90 EKKDPNLSGVQAKVLASKKRKEALKEATAKLRAKGKPVDQP 130