BLASTX nr result
ID: Scutellaria23_contig00000988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00000988 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] 89 4e-16 ref|XP_003574911.1| PREDICTED: uncharacterized protein LOC100846... 89 4e-16 emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] 89 4e-16 ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein o... 89 5e-16 ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein o... 89 5e-16 >emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 2 FGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 124 FGFFVQAIVTGKGP+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 234 FGFFVQAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK 274 >ref|XP_003574911.1| PREDICTED: uncharacterized protein LOC100846020 [Brachypodium distachyon] Length = 560 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +2 Query: 2 FGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK*GLSP 139 FGFFVQAIVTGKGPLENLADHLADPV+NNAWA+ATNFVPGK L P Sbjct: 220 FGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGKEELEP 265 >emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 2 FGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 124 FGFFVQAIVTGKGP+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 234 FGFFVQAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK 274 >ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 265 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 2 FGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 124 FGFFVQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 225 FGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 153 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 2 FGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 124 FGFFVQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 113 FGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 153