BLASTX nr result
ID: Scutellaria23_contig00000777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00000777 (1342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD42938.1|AF084972_1 G-Box binding protein 2 [Catharanthus r... 60 1e-06 ref|XP_003516948.1| PREDICTED: transcription factor HBP-1a [Glyc... 60 2e-06 ref|XP_003612774.1| G-box-binding factor [Medicago truncatula] g... 59 3e-06 emb|CAA52897.1| G-box binding protein [Solanum lycopersicum] 59 3e-06 gb|AAK39130.1|AF369790_1 bZIP transcription factor 2 [Phaseolus ... 59 4e-06 >gb|AAD42938.1|AF084972_1 G-Box binding protein 2 [Catharanthus roseus] Length = 394 Score = 60.1 bits (144), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 738 GVPKWV-VHAYSPMPPHGYMASNPQAHPYMWGVQ 836 G P W AYSP+PPHG++AS+PQAHPYMWGVQ Sbjct: 36 GTPDWTGFQAYSPIPPHGFLASSPQAHPYMWGVQ 69 >ref|XP_003516948.1| PREDICTED: transcription factor HBP-1a [Glycine max] Length = 414 Score = 59.7 bits (143), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +3 Query: 744 PKWV-VHAYSPMPPHGYMASNPQAHPYMWGVQ 836 P+W AYSP+PPHG++ASNPQAHPYMWGVQ Sbjct: 38 PEWPGFQAYSPIPPHGFLASNPQAHPYMWGVQ 69 >ref|XP_003612774.1| G-box-binding factor [Medicago truncatula] gi|355514109|gb|AES95732.1| G-box-binding factor [Medicago truncatula] Length = 444 Score = 58.9 bits (141), Expect = 3e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 762 AYSPMPPHGYMASNPQAHPYMWGVQ 836 AYSPMPPHG+MAS+PQAHPYMWGVQ Sbjct: 44 AYSPMPPHGFMASSPQAHPYMWGVQ 68 >emb|CAA52897.1| G-box binding protein [Solanum lycopersicum] Length = 406 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +3 Query: 744 PKWV-VHAYSPMPPHGYMASNPQAHPYMWGVQ 836 P+W YSPMPPHG+MAS+PQAHPYMWGVQ Sbjct: 25 PEWPGFQGYSPMPPHGFMASSPQAHPYMWGVQ 56 >gb|AAK39130.1|AF369790_1 bZIP transcription factor 2 [Phaseolus vulgaris] Length = 417 Score = 58.5 bits (140), Expect = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +3 Query: 744 PKWV-VHAYSPMPPHGYMASNPQAHPYMWGVQ 836 P W AYSPMPPHG++AS+PQAHPYMWGVQ Sbjct: 37 PDWSNFQAYSPMPPHGFLASSPQAHPYMWGVQ 68