BLASTX nr result
ID: Scutellaria22_contig00038078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00038078 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453471.1| hypothetical protein SORBIDRAFT_04g006460 [S... 64 2e-08 ref|XP_003592856.1| Non-structural maintenance of chromosomes el... 63 2e-08 gb|AFK38609.1| unknown [Medicago truncatula] 63 3e-08 tpg|DAA61616.1| TPA: hypothetical protein ZEAMMB73_417692 [Zea m... 62 5e-08 gb|AFW66207.1| hypothetical protein ZEAMMB73_229055 [Zea mays] 60 1e-07 >ref|XP_002453471.1| hypothetical protein SORBIDRAFT_04g006460 [Sorghum bicolor] gi|241933302|gb|EES06447.1| hypothetical protein SORBIDRAFT_04g006460 [Sorghum bicolor] Length = 353 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/80 (41%), Positives = 44/80 (55%) Frame = -3 Query: 264 PSAEEIKSGAAKNHHFIFRFDFKDWELMRTCVPEGEELMKPRVEFARAEPGCGGYCSQEV 85 P+A I SG HF+FRFDFKDW+LM+ V EGEEL+ R + C++E Sbjct: 251 PAASAIASGEVSYSHFVFRFDFKDWKLMKEAVKEGEELLPHRTSQS-------ALCNEEN 303 Query: 84 VPSDSELIYTAIPLKKLSRN 25 + E P++KLSRN Sbjct: 304 YQPNMEARAQVTPIRKLSRN 323 >ref|XP_003592856.1| Non-structural maintenance of chromosomes element-like protein [Medicago truncatula] gi|355481904|gb|AES63107.1| Non-structural maintenance of chromosomes element-like protein [Medicago truncatula] Length = 384 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = -3 Query: 264 PSAEEIKSGAAKNHHFIFRFDFKDWELMRTCVPEGEELMKPRVEFA-RAEPGCGGYCSQE 88 P+A I S HF+FR+D+KDW++M+ VP+G+ELM R++++ A+P SQE Sbjct: 273 PAANSIMSKEVSYTHFVFRYDYKDWKIMKDIVPDGKELMPHRIQYSTAADP------SQE 326 Query: 87 VVPSDSELIYTAI-PLKKLSRN 25 + DS A+ P++K+SRN Sbjct: 327 EMGGDSSTQALAVTPIRKISRN 348 >gb|AFK38609.1| unknown [Medicago truncatula] Length = 174 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = -3 Query: 264 PSAEEIKSGAAKNHHFIFRFDFKDWELMRTCVPEGEELMKPRVEFARAEPGCGGYCSQEV 85 P+A I S HF+FR+D+KDW++M+ VP+G+ELM R+++ G SQE Sbjct: 63 PAANSIMSKEVSYTHFVFRYDYKDWKIMKDIVPDGKELMPHRIQY-----GTAADPSQEE 117 Query: 84 VPSDSELIYTAI-PLKKLSRN 25 + DS A+ P++K+SRN Sbjct: 118 MGGDSSTQALAVTPIRKISRN 138 >tpg|DAA61616.1| TPA: hypothetical protein ZEAMMB73_417692 [Zea mays] Length = 282 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/80 (38%), Positives = 47/80 (58%) Frame = -3 Query: 264 PSAEEIKSGAAKNHHFIFRFDFKDWELMRTCVPEGEELMKPRVEFARAEPGCGGYCSQEV 85 P+A I SG HF+FRFD KDW+LM+ V EGEEL+ R ++ +C++E Sbjct: 180 PAASAIASGEVSYSHFVFRFDLKDWKLMKEVVTEGEELLPHRTSQSK-------FCNEEN 232 Query: 84 VPSDSELIYTAIPLKKLSRN 25 + E+ +P++KL+RN Sbjct: 233 DQPNLEVRAQIMPIRKLTRN 252 >gb|AFW66207.1| hypothetical protein ZEAMMB73_229055 [Zea mays] Length = 464 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/80 (40%), Positives = 44/80 (55%) Frame = -3 Query: 264 PSAEEIKSGAAKNHHFIFRFDFKDWELMRTCVPEGEELMKPRVEFARAEPGCGGYCSQEV 85 P+A I SG HF+FRFDFKDW+LM+ V EGEEL+ R + C++E Sbjct: 362 PAASAIASGEVSYSHFVFRFDFKDWKLMKEVVTEGEELLPHRTSQS-------NLCNEEN 414 Query: 84 VPSDSELIYTAIPLKKLSRN 25 + E P++KL+RN Sbjct: 415 DQPNLEARAQITPIRKLTRN 434