BLASTX nr result
ID: Scutellaria22_contig00037814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037814 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518350.1| PREDICTED: putative B3 domain-containing pro... 56 3e-06 >ref|XP_003518350.1| PREDICTED: putative B3 domain-containing protein At5g58280-like [Glycine max] Length = 374 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -1 Query: 134 TYEDARKQRLVENKRRFEELGLINLSKNLSDLAKSEKSK 18 TYE+ARKQRL ENK+RFE+LG+ +SKNL+++A S K K Sbjct: 9 TYEEARKQRLEENKKRFEDLGISRISKNLTEIASSAKKK 47