BLASTX nr result
ID: Scutellaria22_contig00037787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037787 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268876.2| PREDICTED: probable glycosyltransferase At5g... 60 2e-07 >ref|XP_002268876.2| PREDICTED: probable glycosyltransferase At5g03795-like [Vitis vinifera] gi|296085575|emb|CBI29307.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/71 (46%), Positives = 41/71 (57%) Frame = +2 Query: 104 NESLACSSSQEHGCDCNHTHPCSVSSSPRLQIKTNPSPYHNWELFDSDYNEMLEKLKIFV 283 NESL +++ + S+SS L SPYHNW+LF SD+ EML KLKIFV Sbjct: 67 NESLNNNNAHHSSAESVQDRNDSLSSGNLLG-----SPYHNWQLFASDFQEMLHKLKIFV 121 Query: 284 YPDVSTSNESS 316 YPD S + SS Sbjct: 122 YPDASMNQSSS 132