BLASTX nr result
ID: Scutellaria22_contig00037712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037712 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521833.1| ATP binding protein, putative [Ricinus commu... 77 2e-12 ref|XP_003520174.1| PREDICTED: uncharacterized protein LOC100809... 75 4e-12 ref|NP_188535.4| phragmoplast orienting kinesin 2 [Arabidopsis t... 72 6e-11 dbj|BAB01702.1| kinesin (centromeric protein)-like protein [Arab... 72 6e-11 ref|XP_002883160.1| hypothetical protein ARALYDRAFT_479423 [Arab... 71 1e-10 >ref|XP_002521833.1| ATP binding protein, putative [Ricinus communis] gi|223538871|gb|EEF40469.1| ATP binding protein, putative [Ricinus communis] Length = 2970 Score = 76.6 bits (187), Expect = 2e-12 Identities = 40/68 (58%), Positives = 52/68 (76%) Frame = -2 Query: 204 NLRVLAQEHPENILQKESQGVLRLSCKQLKSLENTLAGSLRREKMAENSITQLEAEIQLL 25 N+ Q+ + +L ES+G++R+S KQLKSLE TLAG+LRRE+MAE I +LEAEI+ L Sbjct: 622 NIYETDQQQVDGLLGFESKGIVRMSTKQLKSLETTLAGALRREQMAETCIKKLEAEIEQL 681 Query: 24 NRLVSQRE 1 NRLV QRE Sbjct: 682 NRLVRQRE 689 >ref|XP_003520174.1| PREDICTED: uncharacterized protein LOC100809655 [Glycine max] Length = 2881 Score = 75.5 bits (184), Expect = 4e-12 Identities = 45/82 (54%), Positives = 58/82 (70%), Gaps = 2/82 (2%) Frame = -2 Query: 240 DIETRSKDDDDC--NLRVLAQEHPENILQKESQGVLRLSCKQLKSLENTLAGSLRREKMA 67 DI+ + +D C N + +H +N+ ES+G+ R+S KQL SLE TLAG+LRRE+MA Sbjct: 669 DIKQSLELEDCCLENATDMVDQHEDNMPDYESKGI-RMSHKQLHSLETTLAGALRREQMA 727 Query: 66 ENSITQLEAEIQLLNRLVSQRE 1 E SI QLEAEI+ LNRLV QRE Sbjct: 728 EISIKQLEAEIEQLNRLVRQRE 749 >ref|NP_188535.4| phragmoplast orienting kinesin 2 [Arabidopsis thaliana] gi|89160909|gb|ABD62997.1| kinesin POK2 [Arabidopsis thaliana] gi|332642667|gb|AEE76188.1| phragmoplast orienting kinesin 2 [Arabidopsis thaliana] Length = 2771 Score = 71.6 bits (174), Expect = 6e-11 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -2 Query: 186 QEHPENILQKESQGVLRLSCKQLKSLENTLAGSLRREKMAENSITQLEAEIQLLNRLVSQ 7 Q+ N+L ES G +R+S KQLKSLE TLAGSLRRE +A+ SI +LEAEI+ LNRLV Q Sbjct: 596 QQQAGNLLVYESGGCVRMSRKQLKSLEITLAGSLRREHVADASIKKLEAEIEHLNRLVRQ 655 Query: 6 RE 1 RE Sbjct: 656 RE 657 >dbj|BAB01702.1| kinesin (centromeric protein)-like protein [Arabidopsis thaliana] Length = 2756 Score = 71.6 bits (174), Expect = 6e-11 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -2 Query: 186 QEHPENILQKESQGVLRLSCKQLKSLENTLAGSLRREKMAENSITQLEAEIQLLNRLVSQ 7 Q+ N+L ES G +R+S KQLKSLE TLAGSLRRE +A+ SI +LEAEI+ LNRLV Q Sbjct: 596 QQQAGNLLVYESGGCVRMSRKQLKSLEITLAGSLRREHVADASIKKLEAEIEHLNRLVRQ 655 Query: 6 RE 1 RE Sbjct: 656 RE 657 >ref|XP_002883160.1| hypothetical protein ARALYDRAFT_479423 [Arabidopsis lyrata subsp. lyrata] gi|297329000|gb|EFH59419.1| hypothetical protein ARALYDRAFT_479423 [Arabidopsis lyrata subsp. lyrata] Length = 2771 Score = 70.9 bits (172), Expect = 1e-10 Identities = 40/73 (54%), Positives = 49/73 (67%) Frame = -2 Query: 219 DDDDCNLRVLAQEHPENILQKESQGVLRLSCKQLKSLENTLAGSLRREKMAENSITQLEA 40 D + + N+L ES G +R+S KQLKSLE TLAGSLRRE +A+ SI +LEA Sbjct: 585 DSPSSEMHETGHQQAGNLLVYESGGCVRMSRKQLKSLEITLAGSLRREHVADASIKKLEA 644 Query: 39 EIQLLNRLVSQRE 1 EI+ LNRLV QRE Sbjct: 645 EIEHLNRLVRQRE 657