BLASTX nr result
ID: Scutellaria22_contig00037641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037641 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing pr... 60 2e-07 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 57 2e-06 ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing pr... 57 2e-06 >ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128200|gb|AAC16104.1| unknown protein [Arabidopsis thaliana] gi|40822978|gb|AAR92250.1| At2g44370 [Arabidopsis thaliana] gi|45752684|gb|AAS76240.1| At2g44370 [Arabidopsis thaliana] gi|330255319|gb|AEC10413.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 250 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/85 (37%), Positives = 43/85 (50%), Gaps = 10/85 (11%) Frame = -1 Query: 402 PKSAKFEFHPDHALSLVY-PPYSLGAHCQACDGPCDRGFTYNCSLCKLSLHANCVTL--- 235 P+ + + HPDH L L+Y PPY C AC G GFTYNCS+C+ +H CV++ Sbjct: 61 PRETRHKAHPDHPLILLYSPPYESTYTCDAC-GEYGSGFTYNCSICQYDVHVGCVSMPES 119 Query: 234 ------AHPDHTNDRDVYASMFVVN 178 AHP R Y + + N Sbjct: 120 VEREGHAHPLTLLYRSPYQNGLIFN 144 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 6/69 (8%) Frame = -1 Query: 402 PKSAKFEFHPDHALSLVYPPYSLGAH--CQACDGPCDRGFTYNCSLCKLSLHANCV---- 241 P+ + + HPDH L L+Y P + + C AC G GFTYNCS+C+ +H CV Sbjct: 269 PREIRHKSHPDHPLILLYSPQNNNSTYTCDAC-GEYGSGFTYNCSICQYDVHVGCVSVPE 327 Query: 240 TLAHPDHTN 214 T+ H +H + Sbjct: 328 TMKHDEHVH 336 >ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|25336186|pir||H84555 hypothetical protein At2g17740 [imported] - Arabidopsis thaliana gi|34146812|gb|AAQ62414.1| At2g17740 [Arabidopsis thaliana] gi|51968510|dbj|BAD42947.1| unknown protein [Arabidopsis thaliana] gi|51968940|dbj|BAD43162.1| unknown protein [Arabidopsis thaliana] gi|51971363|dbj|BAD44346.1| unknown protein [Arabidopsis thaliana] gi|51971715|dbj|BAD44522.1| unknown protein [Arabidopsis thaliana] gi|330251583|gb|AEC06677.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 6/69 (8%) Frame = -1 Query: 402 PKSAKFEFHPDHALSLVYPPYSLGAH--CQACDGPCDRGFTYNCSLCKLSLHANCV---- 241 P+ + + HPDH L L+Y P + + C AC G GFTYNCS+C+ +H CV Sbjct: 60 PREIRHKSHPDHPLILLYSPQNNNSTYTCDAC-GEYGSGFTYNCSICQYDVHVGCVSVPE 118 Query: 240 TLAHPDHTN 214 T+ H +H + Sbjct: 119 TMKHDEHVH 127