BLASTX nr result
ID: Scutellaria22_contig00037638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037638 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64827.1| hypothetical protein [Beta vulgaris] 64 1e-08 >dbj|BAM64827.1| hypothetical protein [Beta vulgaris] Length = 2403 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = -2 Query: 296 CEVLLQLLYFQRLKWKGVAEPRSLPLIQNWTNEKMSKRCKEEVEAGKYGEGELILNMYPV 117 C +LL+++YF RLK++G E ++PLIQ+WT+EK+ KR K E A +G+G L + YPV Sbjct: 1846 CMLLLEIIYFHRLKFQGKKENPTIPLIQHWTDEKVRKRVKLEKMANDFGQGLLDESTYPV 1905 Query: 116 S 114 S Sbjct: 1906 S 1906