BLASTX nr result
ID: Scutellaria22_contig00037608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037608 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 61 8e-08 ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4... 61 1e-07 ref|XP_002305204.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4... 59 5e-07 ref|XP_002882294.1| armadillo/beta-catenin repeat family protein... 58 7e-07 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -1 Query: 161 VEHTLLLLQSDDLNMRLQAAKEIRRLTKTSQRYRRRFSSAVGHLVDMLTCDS 6 V TL LLQSDD + ++QAAKEIRRLTKTSQ+ RR+ S AV LV ML DS Sbjct: 24 VNRTLHLLQSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRPLVSMLRLDS 75 >ref|XP_003552957.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 384 Score = 60.8 bits (146), Expect = 1e-07 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -1 Query: 161 VEHTLLLLQSDDLNMRLQAAKEIRRLTKTSQRYRRRFSSAVGHLVDMLTCDS 6 V L LL S D ++RLQAA++IRRLTKTSQR RR+ S AVG LV ML DS Sbjct: 29 VRRALQLLNSGDPDLRLQAARDIRRLTKTSQRCRRQLSQAVGPLVSMLRVDS 80 >ref|XP_002305204.1| predicted protein [Populus trichocarpa] gi|222848168|gb|EEE85715.1| predicted protein [Populus trichocarpa] Length = 389 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = -1 Query: 149 LLLLQSDDLNMRLQAAKEIRRLTKTSQRYRRRFSSAVGHLVDML 18 LLL+QSDDL+++++AAKEIRRLTKTSQR RR+ + AV LV ML Sbjct: 35 LLLIQSDDLSLKIEAAKEIRRLTKTSQRCRRQLADAVKPLVCML 78 >ref|XP_003538403.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 392 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -1 Query: 161 VEHTLLLLQSDDLNMRLQAAKEIRRLTKTSQRYRRRFSSAVGHLVDMLTCDS 6 V L LL S ++RLQAA++IRRLTKTSQR RR+ S AVG LV ML DS Sbjct: 37 VRRALQLLNSGQPDLRLQAARDIRRLTKTSQRCRRQLSEAVGPLVSMLRVDS 88 >ref|XP_002882294.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328134|gb|EFH58553.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -1 Query: 161 VEHTLLLLQSDDLNMRLQAAKEIRRLTKTSQRYRRRFSSAVGHLVDMLTCDS 6 ++ L L++S DL+ RL AAKEIRRLTKTS R RR FS AV LV ML DS Sbjct: 66 IQRVLSLIRSKDLDSRLFAAKEIRRLTKTSHRCRRHFSQAVEPLVSMLRFDS 117