BLASTX nr result
ID: Scutellaria22_contig00037562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037562 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|XP_002512343.1| ring finger protein, putative [Ricinus commu... 75 7e-12 gb|ACN37076.1| unknown [Zea mays] 74 2e-11 gb|AFW73525.1| putative RING zinc finger domain superfamily prot... 72 6e-11 gb|AFW73524.1| putative RING zinc finger domain superfamily prot... 72 6e-11 >ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|222856805|gb|EEE94352.1| predicted protein [Populus trichocarpa] Length = 436 Score = 76.6 bits (187), Expect = 2e-12 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -3 Query: 362 TLRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQPWHTNDMESEL 189 TLRL+PKC+H+FHP+C+ AWL H+TCPVCRANL P G P P H +D +++L Sbjct: 155 TLRLIPKCSHVFHPDCIDAWLTSHVTCPVCRANLVPKPGDLPF---NPVHVDDPKNDL 209 >ref|XP_002512343.1| ring finger protein, putative [Ricinus communis] gi|223548304|gb|EEF49795.1| ring finger protein, putative [Ricinus communis] Length = 380 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/59 (52%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = -3 Query: 362 TLRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQ--PWHTNDMESE 192 TLRLLPKC+H+FHP+C+ AWL H TCPVCR+NL P P + T+ P ++D+E++ Sbjct: 135 TLRLLPKCDHVFHPDCIDAWLASHTTCPVCRSNLTPQPVDPPTQTTESLPDSSSDLEAQ 193 >gb|ACN37076.1| unknown [Zea mays] Length = 233 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -3 Query: 362 TLRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQP 219 TLRLLPKC+H+FHP+C+ WL H+TCPVCRANL P A + R QP Sbjct: 147 TLRLLPKCSHVFHPDCIDTWLASHVTCPVCRANLVPDANAQRRRRQQP 194 >gb|AFW73525.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 419 Score = 71.6 bits (174), Expect = 6e-11 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 359 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDP 255 LRLLPKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 139 LRLLPKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173 >gb|AFW73524.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 502 Score = 71.6 bits (174), Expect = 6e-11 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 359 LRLLPKCNHIFHPECVGAWLKFHITCPVCRANLDP 255 LRLLPKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 139 LRLLPKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173