BLASTX nr result
ID: Scutellaria22_contig00037516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037516 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513641.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002513641.1| conserved hypothetical protein [Ricinus communis] gi|223547549|gb|EEF49044.1| conserved hypothetical protein [Ricinus communis] Length = 601 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 16/88 (18%) Frame = +3 Query: 3 PLRPLPDEVIPGPNFLFNPS----------GESDYQESTNP------VGDERLTDSCSKE 134 PLRP+P +IP P+F + + G DYQ + N +E DS SK+ Sbjct: 490 PLRPVPLYLIPDPSFSYASAQVANHIGLANGTLDYQSANNNHEGIMLFSEEYDIDSSSKD 549 Query: 135 EWWHEAIKVADEVEKIQKALDLTQMVSL 218 WW EA KVAD++E ++K ++L+ + ++ Sbjct: 550 SWWLEAAKVADDIENMKKTMELSTLENI 577