BLASTX nr result
ID: Scutellaria22_contig00037464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037464 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142399.1| PREDICTED: putative amidohydrolase YtcJ-like... 55 8e-06 >ref|XP_004142399.1| PREDICTED: putative amidohydrolase YtcJ-like [Cucumis sativus] Length = 545 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/33 (69%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -3 Query: 297 DVYRWADLSGRMKIRVCLYFPIETWTRLH-VIH 202 DVY+WAD SG+M IRVCL+FP+ETW+ LH +IH Sbjct: 251 DVYQWADSSGKMMIRVCLFFPMETWSSLHDLIH 283