BLASTX nr result
ID: Scutellaria22_contig00037385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037385 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279571.1| PREDICTED: uncharacterized protein LOC100264... 58 9e-07 >ref|XP_002279571.1| PREDICTED: uncharacterized protein LOC100264148 [Vitis vinifera] gi|297739834|emb|CBI30016.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 57.8 bits (138), Expect = 9e-07 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = +1 Query: 46 ARVQHVAKASSDQLLMKFAEVGSTENNKISAKELRLAKRSKKSRVKKE--NGDSKISGNS 219 A+VQHV KASSDQLL KFA+ G + AKELR+ KR KKSR +E N +S +G+S Sbjct: 5 AKVQHVTKASSDQLLRKFAQAGGDD---APAKELRVVKRRKKSRRSREGHNRESPPNGSS 61 Query: 220 -LGERKSLL 243 + E++SLL Sbjct: 62 GVVEKRSLL 70