BLASTX nr result
ID: Scutellaria22_contig00037254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037254 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003578806.1| PREDICTED: subtilisin-chymotrypsin inhibitor... 75 6e-12 ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vin... 75 6e-12 tpg|DAA55513.1| TPA: hypothetical protein ZEAMMB73_431437 [Zea m... 73 2e-11 ref|XP_002333004.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus co... 72 4e-11 >ref|XP_003578806.1| PREDICTED: subtilisin-chymotrypsin inhibitor WSCI-like [Brachypodium distachyon] Length = 78 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/64 (54%), Positives = 48/64 (75%) Frame = -1 Query: 227 KSTWPEVVGLTAEEAEMKIKAETPPNTRLHTLPSGSFVTMDYCTNRVRIYIDSSGKVNKP 48 K++WPEVVG+ +EEA+ KI E P + +P+GSFVTMDY T RVR+++DS+ KV+K Sbjct: 16 KNSWPEVVGMLSEEAKKKI-IEDKPEASVQVIPAGSFVTMDYNTGRVRLFVDSNDKVSKA 74 Query: 47 PMIG 36 P IG Sbjct: 75 PRIG 78 >ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vinifera] gi|297740333|emb|CBI30515.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/64 (54%), Positives = 46/64 (71%) Frame = -1 Query: 227 KSTWPEVVGLTAEEAEMKIKAETPPNTRLHTLPSGSFVTMDYCTNRVRIYIDSSGKVNKP 48 K+TWPEVVG+T EEAE KI+ E P + +P FVTMD+ T RVR+++DS GKV++ Sbjct: 48 KTTWPEVVGMTVEEAERKIR-EDMPRVQFQVVPPNCFVTMDFNTRRVRLHVDSEGKVSRA 106 Query: 47 PMIG 36 P IG Sbjct: 107 PRIG 110 >tpg|DAA55513.1| TPA: hypothetical protein ZEAMMB73_431437 [Zea mays] Length = 76 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/64 (53%), Positives = 47/64 (73%) Frame = -1 Query: 227 KSTWPEVVGLTAEEAEMKIKAETPPNTRLHTLPSGSFVTMDYCTNRVRIYIDSSGKVNKP 48 K +WPEVVG+++EEA+ KIK E P + +P+ +FVTMDY T RVR+++DS+ KV K Sbjct: 14 KDSWPEVVGMSSEEAKKKIK-EDKPGADVQVVPADAFVTMDYSTGRVRVFVDSNDKVAKA 72 Query: 47 PMIG 36 P IG Sbjct: 73 PRIG 76 >ref|XP_002333004.1| predicted protein [Populus trichocarpa] gi|222834499|gb|EEE72976.1| predicted protein [Populus trichocarpa] Length = 73 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/64 (54%), Positives = 46/64 (71%) Frame = -1 Query: 227 KSTWPEVVGLTAEEAEMKIKAETPPNTRLHTLPSGSFVTMDYCTNRVRIYIDSSGKVNKP 48 K+TWPE+VGLTAEEAE KIK E P ++ + FVTMD+ NRVR+++DS GK+ + Sbjct: 11 KTTWPELVGLTAEEAERKIK-EEKPGAQIQVVQLDCFVTMDFRQNRVRLHVDSLGKIERA 69 Query: 47 PMIG 36 P IG Sbjct: 70 PRIG 73 >ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus communis] gi|223527228|gb|EEF29391.1| subtilisin inhibitor 1, putative [Ricinus communis] Length = 103 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = -1 Query: 233 PGKSTWPEVVGLTAEEAEMKIKAETPPNTRLHTLPSGSFVTMDYCTNRVRIYIDSSGKVN 54 P + TWP++VG+ AEEAE KIK E P + + F+TMD+ RVR++IDSSGKV Sbjct: 39 PARKTWPDLVGVMAEEAERKIK-EDMPGVEVQVVQPNCFITMDFREGRVRLFIDSSGKVA 97 Query: 53 KPPMIG 36 +PP IG Sbjct: 98 RPPRIG 103