BLASTX nr result
ID: Scutellaria22_contig00037210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037210 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320527.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_002532202.1| Protein ABC1, mitochondrial precursor, putat... 84 2e-14 ref|XP_003605253.1| hypothetical protein MTR_4g027180 [Medicago ... 81 1e-13 ref|XP_003601534.1| hypothetical protein MTR_3g082750 [Medicago ... 81 1e-13 ref|XP_002268128.2| PREDICTED: uncharacterized protein sll1770-l... 79 3e-13 >ref|XP_002320527.1| predicted protein [Populus trichocarpa] gi|222861300|gb|EEE98842.1| predicted protein [Populus trichocarpa] Length = 719 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +3 Query: 147 IVFWDYTTLKVLTLEYVPGIKINELDIIDARGYDRSKISSRAIEAYLI 290 +VFWDYT KVLTLEYVPG+KIN L ++D+RGYDRS+ISSRAIEAYLI Sbjct: 387 LVFWDYTATKVLTLEYVPGVKINHLGMLDSRGYDRSRISSRAIEAYLI 434 >ref|XP_002532202.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] gi|223528098|gb|EEF30171.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] Length = 707 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = +3 Query: 147 IVFWDYTTLKVLTLEYVPGIKINELDIIDARGYDRSKISSRAIEAYLI 290 +VFWDYT +KVLTLEYVPGIKIN+LD++D+RGY+R +ISSRAIE+YLI Sbjct: 375 LVFWDYTAMKVLTLEYVPGIKINQLDMLDSRGYNRPQISSRAIESYLI 422 >ref|XP_003605253.1| hypothetical protein MTR_4g027180 [Medicago truncatula] gi|355506308|gb|AES87450.1| hypothetical protein MTR_4g027180 [Medicago truncatula] Length = 704 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = +3 Query: 147 IVFWDYTTLKVLTLEYVPGIKINELDIIDARGYDRSKISSRAIEAYLI 290 +V+WDYT +KVLTLEYVPGIKIN++D + +RGYDR +ISSRAIEAYLI Sbjct: 372 LVYWDYTAMKVLTLEYVPGIKINQVDTLTSRGYDRLRISSRAIEAYLI 419 >ref|XP_003601534.1| hypothetical protein MTR_3g082750 [Medicago truncatula] gi|355490582|gb|AES71785.1| hypothetical protein MTR_3g082750 [Medicago truncatula] Length = 708 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = +3 Query: 147 IVFWDYTTLKVLTLEYVPGIKINELDIIDARGYDRSKISSRAIEAYLI 290 +V+WDYT +KVLTLEYVPGIKIN++D + +RGYDR +ISSRAIEAYLI Sbjct: 376 LVYWDYTAMKVLTLEYVPGIKINQVDTLTSRGYDRLRISSRAIEAYLI 423 >ref|XP_002268128.2| PREDICTED: uncharacterized protein sll1770-like [Vitis vinifera] Length = 707 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 147 IVFWDYTTLKVLTLEYVPGIKINELDIIDARGYDRSKISSRAIEAYLI 290 +VFWDYT KVLTLEYVPGIKIN D++DARG++RS+I+S AIEAYLI Sbjct: 375 LVFWDYTATKVLTLEYVPGIKINRRDMLDARGFNRSRIASHAIEAYLI 422