BLASTX nr result
ID: Scutellaria22_contig00037138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00037138 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265075.2| PREDICTED: RING-H2 finger protein ATL46-like... 64 1e-08 emb|CAN61651.1| hypothetical protein VITISV_014602 [Vitis vinifera] 64 1e-08 ref|XP_002511433.1| ring finger protein, putative [Ricinus commu... 64 2e-08 ref|XP_002521028.1| ring finger protein, putative [Ricinus commu... 62 5e-08 ref|XP_003634250.1| PREDICTED: receptor-like protein kinase HSL1... 61 1e-07 >ref|XP_002265075.2| PREDICTED: RING-H2 finger protein ATL46-like [Vitis vinifera] Length = 393 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -1 Query: 320 DGDGKKINSRVKGESFSVSKIWLWSKKGKFPSSLTTHYSNAINVSLP 180 D +GKKI+ K ESFSVSKIWLW KKGKFPSS TH ++NV P Sbjct: 339 DVEGKKISIGSKDESFSVSKIWLWPKKGKFPSSSDTHIGPSVNVGFP 385 >emb|CAN61651.1| hypothetical protein VITISV_014602 [Vitis vinifera] Length = 326 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -1 Query: 320 DGDGKKINSRVKGESFSVSKIWLWSKKGKFPSSLTTHYSNAINVSLP 180 D +GKKI+ K ESFSVSKIWLW KKGKFPSS TH ++NV P Sbjct: 272 DVEGKKISIGSKDESFSVSKIWLWPKKGKFPSSSDTHIGPSVNVGFP 318 >ref|XP_002511433.1| ring finger protein, putative [Ricinus communis] gi|223550548|gb|EEF52035.1| ring finger protein, putative [Ricinus communis] Length = 354 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 320 DGDGKKINSRVKGESFSVSKIWLWSKKGKFPSSLTTH 210 D +GKKIN R +G+SFSVSKIWLWSKK KFPSS TT+ Sbjct: 312 DVEGKKINGRTRGDSFSVSKIWLWSKKNKFPSSTTTN 348 >ref|XP_002521028.1| ring finger protein, putative [Ricinus communis] gi|223539865|gb|EEF41445.1| ring finger protein, putative [Ricinus communis] Length = 374 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 320 DGDGKKINSRVKGESFSVSKIWLWSKKGKFPSSLTTHY-SNAINVSLP 180 D +GKKIN R KGESFSVSKIW WS+KGK PSS T+ S+ + V LP Sbjct: 319 DAEGKKINIRSKGESFSVSKIWQWSRKGKLPSSSDTYMGSSPLAVGLP 366 >ref|XP_003634250.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera] Length = 976 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -1 Query: 320 DGDGKKINSRVKGESFSVSKIWLWSKKGKFPSSLTTHYS 204 D +GKKI+SR++GESFSVSKIWLW KK K PSS H S Sbjct: 933 DAEGKKISSRIRGESFSVSKIWLWPKKNKVPSSSDPHMS 971