BLASTX nr result
ID: Scutellaria22_contig00036460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00036460 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284504.2| PREDICTED: two-component response regulator ... 71 1e-10 emb|CBI19004.3| unnamed protein product [Vitis vinifera] 71 1e-10 emb|CBX25288.1| hypothetical_protein [Oryza brachyantha] 55 2e-10 gb|ABG35781.1| SRR197 [Striga asiatica] 55 2e-10 ref|XP_002513745.1| Two-component response regulator ARR9, putat... 69 3e-10 >ref|XP_002284504.2| PREDICTED: two-component response regulator ARR9-like [Vitis vinifera] Length = 240 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 264 DDSNTDRKLLERLLTVSSYQVTCVDSGDKALEYLGLVDIQEND 136 DDS DRKLLE+LLTVSSY VTCV+SGDKALEYLGL+D ++ND Sbjct: 34 DDSLIDRKLLEKLLTVSSYHVTCVESGDKALEYLGLLDGRDND 76 >emb|CBI19004.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 264 DDSNTDRKLLERLLTVSSYQVTCVDSGDKALEYLGLVDIQEND 136 DDS DRKLLE+LLTVSSY VTCV+SGDKALEYLGL+D ++ND Sbjct: 24 DDSLIDRKLLEKLLTVSSYHVTCVESGDKALEYLGLLDGRDND 66 >emb|CBX25288.1| hypothetical_protein [Oryza brachyantha] Length = 200 Score = 54.7 bits (130), Expect(2) = 2e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 264 DDSNTDRKLLERLLTVSSYQVTCVDSGDKALEYLGL 157 DDS DRKL+ERLL SS+QVT VDSG KALE+LGL Sbjct: 15 DDSLPDRKLIERLLKTSSFQVTTVDSGSKALEFLGL 50 Score = 35.4 bits (80), Expect(2) = 2e-10 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = -3 Query: 152 IFKKMINMQYQQQHFLLITNLLHQSLLCKRCLEGGAEEFLVKPVKLSDL 6 + KK+ Y + ++I + + RCLE GA+EF +KPV+LSD+ Sbjct: 86 LLKKIKESSYLRDIPVVIMSSENIPSRINRCLEEGADEFFLKPVRLSDM 134 >gb|ABG35781.1| SRR197 [Striga asiatica] Length = 211 Score = 54.7 bits (130), Expect(2) = 2e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -2 Query: 264 DDSNTDRKLLERLLTVSSYQVTCVDSGDKALEYLG 160 DDS DRKL+ERLL SSYQVT VDSG KALE+LG Sbjct: 16 DDSLIDRKLIERLLKTSSYQVTTVDSGSKALEFLG 50 Score = 35.0 bits (79), Expect(2) = 2e-10 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = -3 Query: 152 IFKKMINMQYQQQHFLLITNLLHQSLLCKRCLEGGAEEFLVKPVKLSDL 6 + KKM + + ++I + + RCLE G EEF +KPV+LSD+ Sbjct: 81 LLKKMKESSFLRDIPVVILSSENVPSRINRCLEEGTEEFFLKPVRLSDV 129 >ref|XP_002513745.1| Two-component response regulator ARR9, putative [Ricinus communis] gi|223546831|gb|EEF48328.1| Two-component response regulator ARR9, putative [Ricinus communis] Length = 229 Score = 69.3 bits (168), Expect = 3e-10 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 264 DDSNTDRKLLERLLTVSSYQVTCVDSGDKALEYLGLVDIQEN 139 DDS DRKLLERLL VSSYQVTCVDSGDKALEYLGL++ EN Sbjct: 46 DDSLLDRKLLERLLRVSSYQVTCVDSGDKALEYLGLLNNLEN 87