BLASTX nr result
ID: Scutellaria22_contig00036135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00036135 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein P... 70 1e-10 ref|XP_002518520.1| homeobox protein, putative [Ricinus communis... 64 2e-08 ref|XP_003527487.1| PREDICTED: homeobox-leucine zipper protein H... 55 8e-06 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/55 (54%), Positives = 48/55 (87%) Frame = +2 Query: 80 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDP 244 M+QPN++D+HH+LLDM +++PE+E+ +RD+E++ ++SG ENM+APSGD +QDP Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFE--SKSGTENMDAPSGD-DQDP 52 >ref|XP_002518520.1| homeobox protein, putative [Ricinus communis] gi|223542365|gb|EEF43907.1| homeobox protein, putative [Ricinus communis] Length = 727 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +2 Query: 80 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDP 244 M+QP ++++HH + DM +S ENEL +L+DD+YD +SG E EAPSGD +QDP Sbjct: 1 MFQPALFESHH-MFDMTPKSSENELGNLKDDDYDHETKSGTETTEAPSGD-DQDP 53 >ref|XP_003527487.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Glycine max] Length = 729 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +2 Query: 80 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDP 244 M+QPN+ D L+MG +PE+E+ +R+DE+D +SG+EN E SG E+QDP Sbjct: 1 MFQPNLMD----ALEMGQNTPESEIPRIREDEFDSATKSGSENHEGASG-EDQDP 50