BLASTX nr result
ID: Scutellaria22_contig00035965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00035965 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ64259.1| RPM1 interacting protein 4 transcript 2b [Lactuca... 64 1e-08 gb|ACZ64248.1| RPM1 interacting protein 4 transcript 2 [Lactuca ... 64 1e-08 ref|XP_002265336.2| PREDICTED: RPM1-interacting protein 4-like [... 64 2e-08 emb|CBI33050.3| unnamed protein product [Vitis vinifera] 64 2e-08 emb|CAN63304.1| hypothetical protein VITISV_002333 [Vitis vinifera] 64 2e-08 >gb|ACZ64259.1| RPM1 interacting protein 4 transcript 2b [Lactuca tatarica] Length = 243 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = +1 Query: 82 MKAVRGDQSPD---GFPKFGEWNENDPQSGEGFSHIFNKVREQRSISLWDGKEQVAMKNS 252 MK VRGD+SPD P+FGEW+EN+P S + ++HIFNKVRE+R A N Sbjct: 165 MKPVRGDESPDRGAAVPRFGEWDENNPSSADNYTHIFNKVREERVTGSPMTSGSDARPNY 224 Query: 253 NYPHEKR 273 N P +++ Sbjct: 225 NIPRDQK 231 >gb|ACZ64248.1| RPM1 interacting protein 4 transcript 2 [Lactuca indica] Length = 243 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = +1 Query: 82 MKAVRGDQSPD---GFPKFGEWNENDPQSGEGFSHIFNKVREQRSISLWDGKEQVAMKNS 252 MK RGD SPD P+FGEW+EN+P S + ++HIFNKVRE+R A N Sbjct: 165 MKPARGDDSPDRGAAVPRFGEWDENNPSSADNYTHIFNKVREERVTGSXMASGSDARPNY 224 Query: 253 NYPHEKR 273 N P +++ Sbjct: 225 NIPRDQK 231 >ref|XP_002265336.2| PREDICTED: RPM1-interacting protein 4-like [Vitis vinifera] Length = 261 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 82 MKAVRGDQSPD---GFPKFGEWNENDPQSGEGFSHIFNKVREQR 204 MK RGD+SPD PKFG+W+EN+P S +G++HIFNKVRE+R Sbjct: 180 MKPTRGDESPDKGAAVPKFGDWDENNPSSADGYTHIFNKVREER 223 >emb|CBI33050.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 82 MKAVRGDQSPD---GFPKFGEWNENDPQSGEGFSHIFNKVREQR 204 MK RGD+SPD PKFG+W+EN+P S +G++HIFNKVRE+R Sbjct: 110 MKPTRGDESPDKGAAVPKFGDWDENNPSSADGYTHIFNKVREER 153 >emb|CAN63304.1| hypothetical protein VITISV_002333 [Vitis vinifera] Length = 599 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 82 MKAVRGDQSPD---GFPKFGEWNENDPQSGEGFSHIFNKVREQR 204 MK RGD+SPD PKFG+W+EN+P S +G++HIFNKVRE+R Sbjct: 187 MKPTRGDESPDKGAAVPKFGDWDENNPSSADGYTHIFNKVREER 230